TkA07G079870 | RubberDandelionOmics

Gene overview

TkA07G079870

Reference: TK1151 Chr: Chr07 Coordinates: 20893858-20897104 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1873 bp · TkA07G079870|TK1151|cDNA

TAAAAACTGAATCCGCTGTTTGAAACGGCCCACTGGAAAACCAAAACCATGGCCCCTAGTATTTCCTTCCCCCTCTCGAAATCAACTCTATCTTTTCAACCAAAACAAAAGAAAATCAACCTCTTTATCTTTGCTTTGCTTTCATCCCATTAAATCCCTCTCCATCATCGTCCCCATCACCTTGATCTTGATCTCAGGTGTTGCATCGTTACTACCAAAAAGATGCAGTCCTTTCCTTGAAAATCATCACCACAAAGTAC...

CDS

Download CDS FASTA

828 bp · TkA07G079870|TK1151|CDS

ATGTTCGATTGCCAAATGGGCATGGAGAAAGTTTCAGGTGAAAGAAAGAAAAGGAGAATGAGGCAGAAGAAAGTTACAGCAGTTCAGAAGCTTTACGATACATGCACGGAGGTCTTCGCCGATTGCGGCCCCGGAATTGTTCCGGCCGCCGAGGGTATCGAACGCCTGAAGGATATATTAAATGGGATAACAGCACTTGACGTTGGTGTACGGCCTAACATGGCCTATTTCAACACTGGAGGACTCCCTATAATCACATA...

Protein

Download Protein FASTA

275 aa · TkA07G079870|TK1151|PROTEIN

MFDCQMGMEKVSGERKKRRMRQKKVTAVQKLYDTCTEVFADCGPGIVPAAEGIERLKDILNGITALDVGVRPNMAYFNTGGLPIITYLHLSECDKFSIGIFLLPPNGVLPLHNHPQMTVFSKLLFGTMHIKAYDWVDNTTSISTPKPDSSEVTETVSLRLAKLKVNADFTAPCNTSILYPTDGGNMHCFTAITSCAVLDVLGPPYCDPEGRHCQYYRTHTFTDLSDDTTDDEKKLLPDGEKTENYAWLEEIDKPKGLTVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G079870`
TK1151 ID	TkA07G079870
OH-1004 ID	LXL04_013351
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 99.636 / OH-1004 98.551 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G079870

Location Chr07:20893858-20897104 (+)

Description Similar to PCO2: Plant cysteine oxidase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39890`	Catalyzes the oxidation of N-terminal cysteine residues (N-Cys), thus preparing the protein for N-end rule pathway-mediated proteasomal degradation, upstream of the N-end rule enzymes ATE1, ATE2 and PRT6.	Molecular basis for cysteine oxidation by plant cysteine oxidases from Arabidopsis thaliana.2021 · DOI: 10.1016/j.jsb.2020.107663
`At5g15120`	Catalyzes the oxidation of N-terminal cysteine residues (N-Cys), thus preparing the protein for N-end rule pathway-mediated proteasomal degradation, upstream of the N-end rule enzymes ATE1, ATE2 and PRT6.	No verified direct reference in this release
`At3g58670`	Catalyzes the oxidation of N-terminal cysteine residues (N-Cys), thus preparing the protein for N-end rule pathway-mediated proteasomal degradation, upstream of the N-end rule enzymes ATE1, ATE2 and PRT6 (Probable).	Structures of Arabidopsis thaliana oxygen-sensing plant cysteine oxidases 4 and 5 enable targeted manipulation of their activity.2020 · DOI: 10.1073/pnas.2000206117 Molecular basis for cysteine oxidation by plant cysteine oxidases from Arabidopsis thaliana.2021 · DOI: 10.1016/j.jsb.2020.107663
`At2g42670`	Catalyzes the oxidation of N-terminal cysteine residues (N-Cys), thus preparing the protein for N-end rule pathway-mediated proteasomal degradation, upstream of the N-end rule enzymes ATE1, ATE2 and PRT6 (Probable).	The plant cysteine oxidases from Arabidopsis thaliana are kinetically tailored to act as oxygen sensors.2018 · DOI: 10.1074/jbc.ra118.003496 Structures of Arabidopsis thaliana oxygen-sensing plant cysteine oxidases 4 and 5 enable targeted manipulation of their activity.2020 · DOI: 10.1073/pnas.2000206117 Molecular basis for cysteine oxidation by plant cysteine oxidases from Arabidopsis thaliana.2021 · DOI: 10.1016/j.jsb.2020.107663
`At1g18490`	Catalyzes the oxidation of N-terminal cysteine residues (N-Cys), thus preparing the protein for N-end rule pathway-mediated proteasomal degradation, upstream of the N-end rule enzymes ATE1, ATE2 and PRT6 (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013351 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0009061 anaerobic respiration Biological Process

GO:0018171 peptidyl-cysteine oxidation Biological Process

GO:0070483 detection of hypoxia Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0017172 cysteine dioxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT1G18490

ath:AT2G42670

ath:AT3G58670

ath:AT5G15120

ath:AT5G39890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.489

Rank 1 · TkA07G079870 · TK1151

Nucleus0.398

Rank 2 · TkA07G079870 · TK1151

Cell membrane0.131

Rank 3 · TkA07G079870 · TK1151

Endoplasmic reticulum0.087

Rank 4 · TkA07G079870 · TK1151

Mitochondrion0.068

Rank 5 · TkA07G079870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07847PCO_ADO59-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G079870	`PF07847`	PCO_ADO	59	269	1.1e-68	231.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LGJ5`	Arabidopsis thaliana	sp\|Q8LGJ5\|PCO2_ARATH Plant cysteine oxidase 2	56.000%	Swiss-Prot	High
`Q9LXG9`	Arabidopsis thaliana	sp\|Q9LXG9\|PCO1_ARATH Plant cysteine oxidase 1	56.500%	Swiss-Prot	High
`Q9LXT4`	Arabidopsis thaliana	sp\|Q9LXT4\|PCO5_ARATH Plant cysteine oxidase 5	39.800%	Swiss-Prot	Medium
`Q9SJI9`	Arabidopsis thaliana	sp\|Q9SJI9\|PCO4_ARATH Plant cysteine oxidase 4	39.900%	Swiss-Prot	Medium
`Q1G3U6`	Arabidopsis thaliana	sp\|Q1G3U6\|PCO3_ARATH Plant cysteine oxidase 3	39.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card