LXL04_013351 | RubberDandelionOmics

Gene overview

LXL04_013351

Reference: OH-1004 Chr: Chr03 Coordinates: 28221434-28223718 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

831 bp · LXL04_013351|LXL04_013351|OH1004|cDNA

ATGTTCGATTGCCAAATGGGCATGGAGAAAGTTTCAGGTGAAAGAAAGAAAAGGAGAATGAGGCAGAAGAAAGTTACAGCAGTTCAGAAGCTTTACGATACATGCACGGAGGTCTTCGCCGATTGCGGCCCCGGAATTGTTCCGGCCGCCGAGGGTATCGAACGCCTGAAGGATATATTAAATGGGATAACAGCACTTGACGTTGGTGTACGGCCTAACATGGCCTATTTCAACACTGGAGGACTCCCTATAATCACATA...

CDS

Download CDS FASTA

831 bp · LXL04_013351|LXL04_013351|OH1004|CDS

ATGTTCGATTGCCAAATGGGCATGGAGAAAGTTTCAGGTGAAAGAAAGAAAAGGAGAATGAGGCAGAAGAAAGTTACAGCAGTTCAGAAGCTTTACGATACATGCACGGAGGTCTTCGCCGATTGCGGCCCCGGAATTGTTCCGGCCGCCGAGGGTATCGAACGCCTGAAGGATATATTAAATGGGATAACAGCACTTGACGTTGGTGTACGGCCTAACATGGCCTATTTCAACACTGGAGGACTCCCTATAATCACATA...

Protein

Download Protein FASTA

276 aa · LXL04_013351|LXL04_013351|OH1004|PROTEIN

MFDCQMGMEKVSGERKKRRMRQKKVTAVQKLYDTCTEVFADCGPGIVPAAEGIERLKDILNGITALDVGVRPNMAYFNTGGLPIITYLHLSECDKFSIGIFLLPPNGVLPLHNHPQMTVFSKLLFGTMHIKAYDWVDNTTSISTPKPDSSEEPVSLRLAKLKVNADFTAPCNTSILYPTDGGNMHCFTAITSCAVLDVLGPPYCDPEGRHCQYYRTHTFTDLSDDTTDDEKKLLPDGEKTENYAWLEEIDKPKGLTVIGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013351`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013351

Location Chr03:28221434-28223718 (+)

Description Similar to PCO2: Plant cysteine oxidase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39890`	Catalyzes the oxidation of N-terminal cysteine residues (N-Cys), thus preparing the protein for N-end rule pathway-mediated proteasomal degradation, upstream of the N-end rule enzymes ATE1, ATE2 and PRT6.	Molecular basis for cysteine oxidation by plant cysteine oxidases from Arabidopsis thaliana.2021 · DOI: 10.1016/j.jsb.2020.107663
`At5g15120`	Catalyzes the oxidation of N-terminal cysteine residues (N-Cys), thus preparing the protein for N-end rule pathway-mediated proteasomal degradation, upstream of the N-end rule enzymes ATE1, ATE2 and PRT6.	No verified direct reference in this release
`At3g58670`	Catalyzes the oxidation of N-terminal cysteine residues (N-Cys), thus preparing the protein for N-end rule pathway-mediated proteasomal degradation, upstream of the N-end rule enzymes ATE1, ATE2 and PRT6 (Probable).	Structures of Arabidopsis thaliana oxygen-sensing plant cysteine oxidases 4 and 5 enable targeted manipulation of their activity.2020 · DOI: 10.1073/pnas.2000206117 Molecular basis for cysteine oxidation by plant cysteine oxidases from Arabidopsis thaliana.2021 · DOI: 10.1016/j.jsb.2020.107663
`At2g42670`	Catalyzes the oxidation of N-terminal cysteine residues (N-Cys), thus preparing the protein for N-end rule pathway-mediated proteasomal degradation, upstream of the N-end rule enzymes ATE1, ATE2 and PRT6 (Probable).	The plant cysteine oxidases from Arabidopsis thaliana are kinetically tailored to act as oxygen sensors.2018 · DOI: 10.1074/jbc.ra118.003496 Structures of Arabidopsis thaliana oxygen-sensing plant cysteine oxidases 4 and 5 enable targeted manipulation of their activity.2020 · DOI: 10.1073/pnas.2000206117 Molecular basis for cysteine oxidation by plant cysteine oxidases from Arabidopsis thaliana.2021 · DOI: 10.1016/j.jsb.2020.107663
`At1g18490`	Catalyzes the oxidation of N-terminal cysteine residues (N-Cys), thus preparing the protein for N-end rule pathway-mediated proteasomal degradation, upstream of the N-end rule enzymes ATE1, ATE2 and PRT6 (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013351 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0009061 anaerobic respiration Biological Process

GO:0018171 peptidyl-cysteine oxidation Biological Process

GO:0070483 detection of hypoxia Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0017172 cysteine dioxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT1G18490

ath:AT2G42670

ath:AT3G58670

ath:AT5G15120

ath:AT5G39890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.483

Rank 1 · LXL04_013351 · OH-1004

Nucleus0.406

Rank 2 · LXL04_013351 · OH-1004

Cell membrane0.138

Rank 3 · LXL04_013351 · OH-1004

Endoplasmic reticulum0.089

Rank 4 · LXL04_013351 · OH-1004

Mitochondrion0.063

Rank 5 · LXL04_013351 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07847.19PCO_ADO59-267 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013351	`PF07847.19`	PCO_ADO	59	267	5.6e-69	232.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LGJ5`	Arabidopsis thaliana	Plant cysteine oxidase 2	56.180%	Swiss-Prot	strong database homology
`Q9LXG9`	Arabidopsis thaliana	Plant cysteine oxidase 1	55.939%	Swiss-Prot	strong database homology
`Q9LXT4`	Arabidopsis thaliana	Plant cysteine oxidase 5	40.157%	Swiss-Prot	moderate database homology
`Q9SJI9`	Arabidopsis thaliana	Plant cysteine oxidase 4	40.476%	Swiss-Prot	moderate database homology
`Q1G3U6`	Arabidopsis thaliana	Plant cysteine oxidase 3	40.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card