RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G079280
Reference: TK1151 Chr: Chr07 Coordinates: 20742858-20745082 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1179 bp · TkA07G079280|TK1151|cDNA

CTAAAAATATGAAGGGCCTGAGGAATTCTGATACACCATTTTACACATCTCTGGAACCGTTTCATGAACTGCTGAACAGGCATCTTGCTCGCGTTCTCTCGATCTGTTGATATCTCCGATCTTCGATCTAGATCCGGTAACAATGACGACGGCACCTGATGTGTTATTTAATCTGCGAAATAACTTCTACTTGGGAGCATATCAAGCTGCCATTAACAACAGTGATGTGCCCAGCCTCAACCAAGAGGACTTAATCGAAC...

CDS

Download CDS FASTA

873 bp · TkA07G079280|TK1151|CDS

ATGACGACGGCACCTGATGTGTTATTTAATCTGCGAAATAACTTCTACTTGGGAGCATATCAAGCTGCCATTAACAACAGTGATGTGCCCAGCCTCAACCAAGAGGACTTAATCGAACGAGATTGCCTTGTGTATAGATCGTACATCGCCCTTGGAAGTTACCAACTTGTGATTAATGAAGTCAATTTATCTGCCGCGACGCCTCTCCAAGCCGTGAAATTGCTCGCATTGTATCTCTCCAGCCCTGATAACAAGGAAAG...

Protein

Download Protein FASTA

290 aa · TkA07G079280|TK1151|PROTEIN

MTTAPDVLFNLRNNFYLGAYQAAINNSDVPSLNQEDLIERDCLVYRSYIALGSYQLVINEVNLSAATPLQAVKLLALYLSSPDNKESTISSIRECLSDDALGNNPILRLIAGTIFMHEQDYNEALKHTNAGGSMELYALNVHIFLKMHRSDYAEKQLRVMQQIDEDHTLTQLATAWLNLAVGGSKIQEAYLIFQDFSEKYQMTSLILNGKAVCSMHMGNFDEAESFLLEALNKDAKDQETLANLIVCCLHLGKPSSRFLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G079280
TK1151 IDTkA07G079280
OH-1004 IDLXL04_033763
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)85.500
Protein coverage (%)TK1151 99.655 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G079280
LocationChr07:20742858-20745082 (-)
DescriptionSimilar to At1g30630: Coatomer subunit epsilon-1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g30630 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release
At2g34840 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0612600 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release
Os04g0644700 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release
UniProt: A2XY73 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_033763 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process
GO:0006891 intra-Golgi vesicle-mediated transport Biological Process
GO:0015031 protein transport Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0000325 plant-type vacuole Cellular Component
GO:0030126 COPI vesicle coat Cellular Component
GO:0005198 structural molecule activity Molecular Function
KEGG gene cross-reference
ath:AT1G30630
ath:AT2G34840
dosa:Os04g0612600
dosa:Os04g0644700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.500
Rank 1 · TkA07G079280 · TK1151
Nucleus0.299
Rank 2 · TkA07G079280 · TK1151
Golgi apparatus0.238
Rank 3 · TkA07G079280 · TK1151
Lysosome / Vacuole0.152
Rank 4 · TkA07G079280 · TK1151
Endoplasmic reticulum0.079
Rank 5 · TkA07G079280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04733Coatomer_E5-289 aa
PF00515TPR_115-24 aa
PF07719TPR_215-24 aa
PF12895ANAPC317-55 aa
PF13181TPR_846-53 aa
PF13428TPR_1470-84 aa
PF13432TPR_1699-125 aa
PF14559TPR_19107-126 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G079280PF04733Coatomer_E52894.5e-131437.3
TkA07G079280PF00515TPR_115242.3e-0627.9
TkA07G079280PF07719TPR_215241.2e-0525.8
TkA07G079280PF12895ANAPC317550.1712.9
TkA07G079280PF13181TPR_846530.4711.5
TkA07G079280PF13428TPR_1470840.04115.3
TkA07G079280PF13432TPR_16991250.09313.9
TkA07G079280PF14559TPR_191071267.1e-0730.2
TkA07G079280PF13428TPR_141081270.04115.3
TkA07G079280PF00515TPR_11121272.3e-0627.9
TkA07G079280PF07719TPR_21121281.2e-0525.8
TkA07G079280PF13424TPR_121121270.0001822.3
TkA07G079280PF13176TPR_71121260.003218.2
TkA07G079280PF13181TPR_81121260.4711.5
TkA07G079280PF25060ARM_TT21_2nd1131720.02914.6
TkA07G079280PF12895ANAPC31141280.1712.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SA78Arabidopsis thalianasp|Q9SA78|COPE1_ARATH Coatomer subunit epsilon-179.700%Swiss-ProtHigh
O64748Arabidopsis thalianasp|O64748|COPE2_ARATH Coatomer subunit epsilon-277.600%Swiss-ProtHigh
Q9MAX6Oryza sativa subsp. japonicasp|Q9MAX6|COPE1_ORYSJ Coatomer subunit epsilon-175.600%Swiss-ProtHigh
P0C541Oryza sativa subsp. japonicasp|P0C541|COPE2_ORYSJ Coatomer subunit epsilon-265.800%Swiss-ProtHigh
A2XY73Oryza sativa subsp. indicasp|A2XY73|COPE2_ORYSI Coatomer subunit epsilon-265.800%Swiss-ProtHigh

JBrowse

View in Genome Browser