LXL04_033763 | RubberDandelionOmics

Gene overview

LXL04_033763

Reference: OH-1004 Chr: Chr07 Coordinates: 56511043-56513773 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

870 bp · LXL04_033763|LXL04_033763|OH1004|cDNA

ATGGCGGCAACACCAGATTTGTTGTTTGGATTGAGAAATAACTTTTACTTGGGAGCATATCAAGCTGCCATTAACAGCGGTGATGTTCAAAACCTCAAAGAAGAGGATGCAATCGAAAGAGACTGCCTCATTTACAGATCCTACATTGCACTGGGAAGCTACCAACTCGTGGTTAACGAGGTCGATTCATCTGCGGCAACGCCTCTCCAAGCCGTGAAGCTACTCGCTTTGTATCTTTTGAGCACCGACAATAAGGAAAC...

CDS

Download CDS FASTA

870 bp · LXL04_033763|LXL04_033763|OH1004|CDS

ATGGCGGCAACACCAGATTTGTTGTTTGGATTGAGAAATAACTTTTACTTGGGAGCATATCAAGCTGCCATTAACAGCGGTGATGTTCAAAACCTCAAAGAAGAGGATGCAATCGAAAGAGACTGCCTCATTTACAGATCCTACATTGCACTGGGAAGCTACCAACTCGTGGTTAACGAGGTCGATTCATCTGCGGCAACGCCTCTCCAAGCCGTGAAGCTACTCGCTTTGTATCTTTTGAGCACCGACAATAAGGAAAC...

Protein

Download Protein FASTA

289 aa · LXL04_033763|LXL04_033763|OH1004|PROTEIN

MAATPDLLFGLRNNFYLGAYQAAINSGDVQNLKEEDAIERDCLIYRSYIALGSYQLVVNEVDSSAATPLQAVKLLALYLLSTDNKETAISSIREWLDDPAIGNNPILRLIAGIIFMHEQDYNEALKYTNVGGTMELNALNVQIFLKMHRSDYAEKQLRVMQQIDEDHTLTQLATAWLNLAVGGSKIQEAYLIFQDFSEKYQMTSLILNGKAVCCMHMGNFDEAESFLLEALNKDAKDPETLANLVVCSLHLGKPSSRFLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033763`
TK1151 ID	TkA07G079280
OH-1004 ID	LXL04_033763
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.500
Protein coverage (%)	TK1151 99.655 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033763

Location Chr07:56511043-56513773 (+)

Description Similar to At1g30630: Coatomer subunit epsilon-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30630`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release
`At2g34840`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0612600`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release
`Os04g0644700`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release
`UniProt: A2XY73`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033763 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0015031 protein transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0030126 COPI vesicle coat Cellular Component

GO:0005198 structural molecule activity Molecular Function

KEGG gene cross-reference

ath:AT1G30630

ath:AT2G34840

dosa:Os04g0612600

dosa:Os04g0644700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.489

Rank 1 · LXL04_033763 · OH-1004

Golgi apparatus0.276

Rank 2 · LXL04_033763 · OH-1004

Nucleus0.271

Rank 3 · LXL04_033763 · OH-1004

Lysosome / Vacuole0.144

Rank 4 · LXL04_033763 · OH-1004

Endoplasmic reticulum0.094

Rank 5 · LXL04_033763 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04733.21Coatomer_E4-288 aa

PF14559.13TPR_19209-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033763	`PF04733.21`	Coatomer_E	4	288	4e-131	437.4
LXL04_033763	`PF14559.13`	TPR_19	209	239	7.9e-08	33.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA78`	Arabidopsis thaliana	Coatomer subunit epsilon-1	79.720%	Swiss-Prot	strong database homology
`O64748`	Arabidopsis thaliana	Coatomer subunit epsilon-2	78.201%	Swiss-Prot	strong database homology
`Q9MAX6`	Oryza sativa subsp. japonica	Coatomer subunit epsilon-1	75.610%	Swiss-Prot	strong database homology
`P0C541`	Oryza sativa subsp. japonica	Coatomer subunit epsilon-2	67.119%	Swiss-Prot	strong database homology
`A2XY73`	Oryza sativa subsp. indica	Coatomer subunit epsilon-2	67.119%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card