TkA07G060220 | RubberDandelionOmics

Gene overview

TkA07G060220

Reference: TK1151 Chr: Chr07 Coordinates: 15952925-15955074 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

663 bp · TkA07G060220|TK1151|cDNA

ATGGCCGGTAGCGGTGTGGTGCGATGGTGGTTGACAAATGACTATCACTGGTGTGGGGTGGGAGGTATTCTTGGTGGTGGTTACAGGGCCGGTGATAGTGAGCAGGGTATGTTTCTGAAATTACCCTTCATTCGCCCCGTCACTGTATTCGATTTGAGCGGCATTGGATTGAACGTCATGGATAACACGCAGGGCAATAAGGATTCAGTCACAGAACTATCAAAGAACGGGACCGACTTTACTCTCGTTTGTTTGAACAA...

CDS

Download CDS FASTA

663 bp · TkA07G060220|TK1151|CDS

ATGGCCGGTAGCGGTGTGGTGCGATGGTGGTTGACAAATGACTATCACTGGTGTGGGGTGGGAGGTATTCTTGGTGGTGGTTACAGGGCCGGTGATAGTGAGCAGGGTATGTTTCTGAAATTACCCTTCATTCGCCCCGTCACTGTATTCGATTTGAGCGGCATTGGATTGAACGTCATGGATAACACGCAGGGCAATAAGGATTCAGTCACAGAACTATCAAAGAACGGGACCGACTTTACTCTCGTTTGTTTGAACAA...

Protein

Download Protein FASTA

220 aa · TkA07G060220|TK1151|PROTEIN

MAGSGVVRWWLTNDYHWCGVGGILGGGYRAGDSEQGMFLKLPFIRPVTVFDLSGIGLNVMDNTQGNKDSVTELSKNGTDFTLVCLNKVCLLGDAQHIEEAQNIGLKYRDVEGLKKLNKNKKLVKKRAKKHQHFLASTGLLTELSKNGTDFTLVCLNKVCLLRDAQHIEEAQNIGLKYRDVEGLKKLNKNKKLSEAAGVDKVGHNRLVILTGCCAEGDERP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G060220`
TK1151 ID	TkA07G060220
OH-1004 ID	LXL04_032932
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	72.900
Protein coverage (%)	TK1151 26.818 / OH-1004 27.315 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G060220

Location Chr07:15952925-15955074 (-)

Description Similar to RPL10AA: 60S ribosomal protein L10a-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08360`	Large ribosomal subunit protein uL1z.	No verified direct reference in this release
`At5g22440`	Large ribosomal subunit protein uL1x.	No verified direct reference in this release
`At2g27530`	Large ribosomal subunit protein uL1y.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8B9K6`	Large ribosomal subunit protein uL1.	No verified direct reference in this release
`Os08g0558800`	Large ribosomal subunit protein uL1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032932 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0090696 post-embryonic plant organ development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0015934 large ribosomal subunit Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G08360

ath:AT2G27530

ath:AT5G22440

dosa:Os08g0558800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.502

Rank 1 · TkA07G060220 · TK1151

Nucleus0.258

Rank 2 · TkA07G060220 · TK1151

Mitochondrion0.144

Rank 3 · TkA07G060220 · TK1151

Cell membrane0.099

Rank 4 · TkA07G060220 · TK1151

Extracellular0.090

Rank 5 · TkA07G060220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00687Ribosomal_L186-147 aa

PF04705TSNR_N87-128 aa

PF03728Viral_DNA_Zn_bi90-136 aa

PF00581Rhodanese94-125 aa

PF14506CppA_N96-141 aa

PF06819Arc_PepC97-123 aa

PF00687Ribosomal_L1156-192 aa

PF04705TSNR_N157-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G060220	`PF00687`	Ribosomal_L1	86	147	1e-07	32.5
TkA07G060220	`PF04705`	TSNR_N	87	128	0.081	13.6
TkA07G060220	`PF03728`	Viral_DNA_Zn_bi	90	136	0.16	13.3
TkA07G060220	`PF00581`	Rhodanese	94	125	0.36	12.0
TkA07G060220	`PF14506`	CppA_N	96	141	0.046	14.5
TkA07G060220	`PF06819`	Arc_PepC	97	123	0.02	15.8
TkA07G060220	`PF00687`	Ribosomal_L1	156	192	1e-07	32.5
TkA07G060220	`PF04705`	TSNR_N	157	205	0.081	13.6
TkA07G060220	`PF03728`	Viral_DNA_Zn_bi	161	215	0.16	13.3
TkA07G060220	`PF00581`	Rhodanese	164	193	0.36	12.0
TkA07G060220	`PF06819`	Arc_PepC	166	194	0.02	15.8
TkA07G060220	`PF14506`	CppA_N	166	188	0.046	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZB9`	Arabidopsis thaliana	sp\|Q8VZB9\|R10A1_ARATH Large ribosomal subunit protein uL1z	61.000%	Swiss-Prot	Low
`P59231`	Arabidopsis thaliana	sp\|P59231\|R10A3_ARATH Large ribosomal subunit protein uL1x	62.700%	Swiss-Prot	Low
`P59230`	Arabidopsis thaliana	sp\|P59230\|R10A2_ARATH Large ribosomal subunit protein uL1y	59.300%	Swiss-Prot	Low
`B8B9K6`	Oryza sativa subsp. indica	sp\|B8B9K6\|R10A_ORYSI Large ribosomal subunit protein uL1	64.400%	Swiss-Prot	Low
`B7F845`	Oryza sativa subsp. japonica	sp\|B7F845\|R10A_ORYSJ Large ribosomal subunit protein uL1	64.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card