TkA07G058470 | RubberDandelionOmics

Gene overview

TkA07G058470

Reference: TK1151 Chr: Chr07 Coordinates: 15474472-15476358 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1802 bp · TkA07G058470|TK1151|cDNA

CATCGGAAACACGTTTCGGCTTAGGCGAAAGTAAGTCACTATCTGCTGGTGTGCAAGGCTCTGGTGTGTGATGATGAAGCCGATTGCTCTTGCCTCTTCCAATCTCACTACTAAATTCTGCAAGTGTCTTTATTTCCGCTGTGCATTTTACTCTCCTCGGACAAATTTTGAAGGATGTTCAAAAAAGTATAGTTCCGTACCTGGTGACCTAGCTCTAGGCGATGCATTGTTGGTGTTCGATAAAATGCTTCAAAGACGAC...

CDS

Download CDS FASTA

963 bp · TkA07G058470|TK1151|CDS

ATGTTTGCTCAAAATATCCCACGCAATTTACAAACGTATAACATCTTAATTGATGCATTATGTAAAGAAGGGAAAGCAATAGAAGCACACCATCTGTTTGCATCCATGATTAAAGAAGGTGCATCACCCGATATTTTTACTTACAGTTCATTAATAGATGGCTATTGTTTACTCGGCAGGGTTAACGAGGCAAGAAATTTGTTCGATCAAATGATGAGCCATAATTGTGCACCTTCTGTTGTAACTTATAGTACTTTAAT...

Protein

Download Protein FASTA

320 aa · TkA07G058470|TK1151|PROTEIN

MFAQNIPRNLQTYNILIDALCKEGKAIEAHHLFASMIKEGASPDIFTYSSLIDGYCLLGRVNEARNLFDQMMSHNCAPSVVTYSTLINGYCKCKRIDEALSLFKGMSRNGIDPNVVTYTALIKGLCHKGRLKDALMLFDEMKTCGLEANIVTYITLVDSLCKHKRVEEALEMFAKIDGVGLAPNIVIYSCLIDGLCKDGKLEAANKLFSELLERGLKPNVRTYTVMINGFCKRGKLDEAEELLSKMSDNGCSPNEFTYNI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G058470`
TK1151 ID	TkA07G058470
OH-1004 ID	LXL04_022290
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.600
Protein coverage (%)	TK1151 9.688 / OH-1004 8.587 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G058470`
Location	Chr07:15474472-15476358 (+)
Description	Similar to At1g12300: Pentatricopeptide repeat-containing protein At1g12300, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022290` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0090615 mitochondrial mRNA processing Biological Process GO:0005739 mitochondrion Cellular Component GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference	ath:AT1G12300 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.538

Rank 1 · TkA07G058470 · TK1151

Nucleus0.123

Rank 2 · TkA07G058470 · TK1151

Cytoplasm0.118

Rank 3 · TkA07G058470 · TK1151

Plastid0.093

Rank 4 · TkA07G058470 · TK1151

Cell membrane0.019

Rank 5 · TkA07G058470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29070MSC6_N1-69 aa

PF29978ATP18_TPR2-36 aa

PF13812PPR_33-53 aa

PF17177PPR_long4-129 aa

PF06239ECSIT_N5-23 aa

PF12854PPR_16-36 aa

PF30136MSC6_C7-57 aa

PF13041PPR_29-56 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G058470	`PF29070`	MSC6_N	1	69	1.8e-24	87.3
TkA07G058470	`PF29978`	ATP18_TPR	2	36	1e-06	29.4
TkA07G058470	`PF13812`	PPR_3	3	53	1.3e-55	186.0
TkA07G058470	`PF17177`	PPR_long	4	129	3.2e-28	99.3
TkA07G058470	`PF06239`	ECSIT_N	5	23	0.09	12.8
TkA07G058470	`PF12854`	PPR_1	6	36	6.7e-104	340.0
TkA07G058470	`PF30136`	MSC6_C	7	57	0.00027	21.1
TkA07G058470	`PF13041`	PPR_2	9	56	1.5e-118	387.5
TkA07G058470	`PF25058`	ARM_TT21	9	39	1.6e-07	32.1
TkA07G058470	`PF24760`	TPR_IF140_C	9	36	6.9e-07	30.4
TkA07G058470	`PF08579`	RPM2	9	22	0.00034	21.7
TkA07G058470	`PF28722`	WHD_Sfc3_5th	10	35	0.039	14.9
TkA07G058470	`PF14183`	YwpF	11	43	0.037	14.7
TkA07G058470	`PF11846`	Wzy_C_2	11	36	0.4	11.4
TkA07G058470	`PF01535`	PPR	12	40	4.5e-79	256.1
TkA07G058470	`PF23276`	TPR_24	12	44	1.2e-24	87.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card