TkA07G056680 | RubberDandelionOmics

Gene overview

TkA07G056680

Reference: TK1151 Chr: Chr07 Coordinates: 15088123-15089814 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1592 bp · TkA07G056680|TK1151|cDNA

CGACGATATAAAAATATGTTTAAAAGTTAAAACATGTAAAAGATAAAGAAAATCTATACATAAAAAGGAGGAGCGTGTAGTCCACGAAAAAGAGAAAGGGAGTATGAATCCGTGTTATGCCGTACAGTTCATTGCAGACTAATCTATACTGGATAATTCGTCCAAATAGAGTGCGTATCAGAGAAAATCCCAAAAACTGTTATTGTTTGTATTCAAAATTGTTCTTGTATCGTTACAGTATAGTTTCTCGGAGGGAAAGC...

CDS

Download CDS FASTA

882 bp · TkA07G056680|TK1151|CDS

ATGGAAATGTTGGAAGAAGGTGAAAATCAACACAAAGTTGGCCAAAAATGGATGAACTCTGAAGGAATCGTTGTGGAATGCGGAGAAGATCGAATCAGTATGTTGCAAGATTGCTTACTTCTAGAAATCCTCTCTTGTTTACCTTCCACAAAAGACGCCATCAAAACAGGTACTCTCTCCAAACGATGGGAGCATCTTTGGACTTCGGTCCCTATTCTCAGCTTCACGAGTACAGACTATTATCTCGCCAATCAAGATGG...

Protein

Download Protein FASTA

293 aa · TkA07G056680|TK1151|PROTEIN

MEMLEEGENQHKVGQKWMNSEGIVVECGEDRISMLQDCLLLEILSCLPSTKDAIKTGTLSKRWEHLWTSVPILSFTSTDYYLANQDGLNPNSMSDFFSLVTKTLTQCPPLHLKKFKVRSGYDIRFESQVNSWIRYAVNRGVEELYLSFRSGPFVDVSLDQSFFTCSSFTNLTLKRYQLNPTGAISWNNLRNLCLDFGKLDEGLIENILSGSPVLESLELGSGHGYKRLNITSKSVKKLVISGYIQVDEIVTINAPDILSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G056680`
TK1151 ID	TkA07G056680
OH-1004 ID	LXL04_027366
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	55.100
Protein coverage (%)	TK1151 97.611 / OH-1004 12.550 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G056680

Location Chr07:15088123-15089814 (+)

Description Similar to At1g49610: Putative F-box protein At1g49610

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02930`	Putative F-box/LRR-repeat protein At5g02930.	No verified direct reference in this release
`At5g02920`	F-box/LRR-repeat protein 25.	No verified direct reference in this release
`At5g02910`	F-box/LRR-repeat protein At5g02910.	No verified direct reference in this release
`At3g60790`	F-box protein At3g60790.	No verified direct reference in this release
`At3g44080`	Putative F-box/LRR-repeat protein At3g44080.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027366 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G49610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.911

Rank 1 · TkA07G056680 · TK1151

Cytoplasm0.140

Rank 2 · TkA07G056680 · TK1151

Cell membrane0.029

Rank 3 · TkA07G056680 · TK1151

Endoplasmic reticulum0.027

Rank 4 · TkA07G056680 · TK1151

Plastid0.015

Rank 5 · TkA07G056680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box32-73 aa

PF24758LRR_At5g5637033-49 aa

PF23622LRR_At1g61320_AtMIF144-108 aa

PF23622LRR_At1g61320_AtMIF1113-284 aa

PF24758LRR_At5g56370130-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G056680	`PF00646`	F-box	32	73	0.003	18.1
TkA07G056680	`PF24758`	LRR_At5g56370	33	49	5.3e-19	69.5
TkA07G056680	`PF23622`	LRR_At1g61320_AtMIF1	44	108	3.2e-12	47.2
TkA07G056680	`PF23622`	LRR_At1g61320_AtMIF1	113	284	3.2e-12	47.2
TkA07G056680	`PF24758`	LRR_At5g56370	130	265	5.3e-19	69.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYZ2`	Arabidopsis thaliana	sp\|Q9LYZ2\|FBL80_ARATH Putative F-box/LRR-repeat protein At5g02930	36.500%	Swiss-Prot	Medium
`Q1PE04`	Arabidopsis thaliana	sp\|Q1PE04\|FBL25_ARATH F-box/LRR-repeat protein 25	32.900%	Swiss-Prot	Medium
`Q9LYZ4`	Arabidopsis thaliana	sp\|Q9LYZ4\|FBL79_ARATH F-box/LRR-repeat protein At5g02910	33.000%	Swiss-Prot	Medium
`Q9LZY4`	Arabidopsis thaliana	sp\|Q9LZY4\|FB213_ARATH F-box protein At3g60790	32.800%	Swiss-Prot	Medium
`Q9LXQ4`	Arabidopsis thaliana	sp\|Q9LXQ4\|FBL50_ARATH Putative F-box/LRR-repeat protein At3g44080	36.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card