TkA07G053140 | RubberDandelionOmics

Gene overview

TkA07G053140

Reference: TK1151 Chr: Chr07 Coordinates: 14161174-14165040 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2564 bp · TkA07G053140|TK1151|cDNA

GAGCTCTGTTTGCTGCCATCGAAATGGTGGAAGAAGGAGAAACTCAACCTAAAATTTCCAGAAAACGGATAATTTCTGGAGAATTCATAGAGGAGGTGGGAGAAGATCGAATCGGTGCGCTGCCAGATTCCGTGCTTATCGAAATCCTGTCTCGTTTACCCTCCACAAAAGACGCCATTAAAACAGGTATTCTCTCCAAGCGATGGAAACATGTTTGGACTTCGGTACCTACTCTAATTTTCGAACACAACGCTTATAAT...

CDS

Download CDS FASTA

1248 bp · TkA07G053140|TK1151|CDS

ATGGCTGGAGTAAGGCAACGTCGTCAGGTATTGATCGATGTTGGACGTGCCCTTGTGAATTCGATGGAAGAAATGATCGATATTATAGAAGAAGAGGAGGAACTCGAGGCGGAAACGTCGACTAAGAAGACAGGCAAACATATTATTAGAGATCGTCTTGGTGCCATTAAAACGGTGGAAGGACAGAGTAAAGTTAAAGCTTCCCGTAAACGGATAAAGCCTAAAAAAGCCATGGCGAAGGGGGAAGAAGATCGAATCAG...

Protein

Download Protein FASTA

415 aa · TkA07G053140|TK1151|PROTEIN

MAGVRQRRQVLIDVGRALVNSMEEMIDIIEEEEELEAETSTKKTGKHIIRDRLGAIKTVEGQSKVKASRKRIKPKKAMAKGEEDRISSLPDCLLLEILSRLPSTKDAIKTGTLSKRWKNIWTLVPILIFDCRHERDLKPSDFVSFVDKTLTQRRQLKLKTLILLTYSDIQFQSQISNWLRYAISCNVEELGVSFLKTFPLDQYFFICSSFTDLTLNSGILKPTGAISWRNLTSLCIRYAELDEDLIENIFSGSPVLEKLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G053140`
TK1151 ID	TkA07G053140
OH-1004 ID	LXL04_027366
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.700
Protein coverage (%)	TK1151 94.699 / OH-1004 17.366 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G053140

Location Chr07:14161174-14165040 (+)

Description Similar to At1g49610: Putative F-box protein At1g49610

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49610`	Putative F-box protein At1g49610.	No verified direct reference in this release
`At5g03100`	F-box protein At5g03100.	No verified direct reference in this release
`At3g03360`	F-box/LRR-repeat protein At3g03360.	No verified direct reference in this release
`At5g02910`	F-box/LRR-repeat protein At5g02910.	No verified direct reference in this release
`At5g02930`	Putative F-box/LRR-repeat protein At5g02930.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027366 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G49610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · TkA07G053140 · TK1151

Cytoplasm0.096

Rank 2 · TkA07G053140 · TK1151

Cell membrane0.028

Rank 3 · TkA07G053140 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA07G053140 · TK1151

Plastid0.015

Rank 5 · TkA07G053140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24104At5g52880_ARM40-65 aa

PF00646F-box86-127 aa

PF12937F-box-like86-120 aa

PF23622LRR_At1g61320_AtMIF1153-316 aa

PF24104At5g52880_ARM166-186 aa

PF24758LRR_At5g56370176-314 aa

PF00646F-box241-251 aa

PF00646F-box273-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G053140	`PF24104`	At5g52880_ARM	40	65	0.16	13.1
TkA07G053140	`PF00646`	F-box	86	127	1.8e-05	25.2
TkA07G053140	`PF12937`	F-box-like	86	120	0.00038	20.9
TkA07G053140	`PF23622`	LRR_At1g61320_AtMIF1	153	316	1.6e-14	54.8
TkA07G053140	`PF24104`	At5g52880_ARM	166	186	0.16	13.1
TkA07G053140	`PF24758`	LRR_At5g56370	176	314	6.6e-11	43.0
TkA07G053140	`PF00646`	F-box	241	251	1.8e-05	25.2
TkA07G053140	`PF00646`	F-box	273	282	1.8e-05	25.2
TkA07G053140	`PF24104`	At5g52880_ARM	329	365	0.16	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FX89`	Arabidopsis thaliana	sp\|Q9FX89\|FB50_ARATH Putative F-box protein At1g49610	33.700%	Swiss-Prot	Medium
`Q501G5`	Arabidopsis thaliana	sp\|Q501G5\|FB250_ARATH F-box protein At5g03100	31.600%	Swiss-Prot	Medium
`Q84W80`	Arabidopsis thaliana	sp\|Q84W80\|FBL42_ARATH F-box/LRR-repeat protein At3g03360	31.600%	Swiss-Prot	Medium
`Q9LYZ4`	Arabidopsis thaliana	sp\|Q9LYZ4\|FBL79_ARATH F-box/LRR-repeat protein At5g02910	30.700%	Swiss-Prot	Medium
`Q9LYZ2`	Arabidopsis thaliana	sp\|Q9LYZ2\|FBL80_ARATH Putative F-box/LRR-repeat protein At5g02930	29.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card