RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G045610
Reference: TK1151 Chr: Chr07 Coordinates: 12153642-12158300 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3914 bp · TkA07G045610|TK1151|cDNA

TTAAAGATAGCTTTTCCATCACCAAGCAAGGCATAAATATCGATAATGATGACATTGATCCCCAGCTTTCCAAAATCTTGCTTTAAATAAAAAAACTTAATATACATTGAATAACAATTACTTCTTTTTTAATAAAAATACTAATTGATGTTTCTCCTCTTTTGCATCATCATCATAAAAGGGGAATGAAATTATTGAATACAAAATCCAAATTGATGTTTCTCCTCTTTTGCATCATCATCATCATCGTAATCAACCCC...

CDS

Download CDS FASTA

2994 bp · TkA07G045610|TK1151|CDS

ATGTCACGCTCTCTCTGTTGTGTTTTGTTATTCTTGATGCCGTTTGGTCTTTGTTTGAATCAAGAGGGGAGTTATCTGCAACAGATGAAGCTTGGATTTGATGACCCAGATGGGTTTTTCGCCGACTGGAATGATGCCGCCGGTGATACCCCTTGTCATTGGACCGGTGTTACTTGTTCTGAACCGGGAAGTGGGTTTGTTGTCGGTGTTGATTTATCAAATGCTAATGTTGCCGGTCCTTTTCCGTCTGTTCTGTGCCG...

Protein

Download Protein FASTA

997 aa · TkA07G045610|TK1151|PROTEIN

MSRSLCCVLLFLMPFGLCLNQEGSYLQQMKLGFDDPDGFFADWNDAAGDTPCHWTGVTCSEPGSGFVVGVDLSNANVAGPFPSVLCRLTGLKFISLYNNSINGTLSDDLSTCRSLVHLNLAQNLLTGKLPHSLSELPELKYLDLTGNNFSGDIPASFGLFQKLEVISLVDNLIDGKIPAELGNVSTLKQLNLSYNPFSSGQIPPELGNLTNLEVLWLTGCSLIGQIPESLGRLSKLVDLDLAINKLTGPVPSSLTELSNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G045610
TK1151 IDTkA07G045610
OH-1004 IDLXL04_027291
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G045610
LocationChr07:12153642-12158300 (-)
DescriptionSimilar to HSL1: Receptor-like protein kinase HSL1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g28440 Receptor-like protein kinase HSL1. No verified direct reference in this release
At4g28490 Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates that controls floral organ abscission. No verified direct reference in this release
At5g65700 LRR-rich receptor-like kinase (LRR-RLK) that, similarly to CLV1 and BAM3, participates in the detection of the CLAVATA-family peptides (e.g. CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and of PBL34, PBL35 and PBL36. No verified direct reference in this release
At3g49670 LRR-rich receptor-like kinase (LRR-RLK) implicated in the detection of the CLAVATA-family peptides (CLEs), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and, probably, of PBL34, PBL35 and PBL36. No verified direct reference in this release
At5g65710 Receptor-like serine/threonine-kinase acting on substrates that controls floral organ abscission. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_027291 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0009755 hormone-mediated signaling pathway Biological Process
GO:0009845 seed germination Biological Process
GO:0009934 regulation of meristem structural organization Biological Process
GO:0010075 regulation of meristem growth Biological Process
GO:0010102 lateral root morphogenesis Biological Process
GO:0010227 floral organ abscission Biological Process
GO:0010468 regulation of gene expression Biological Process
GO:0030154 cell differentiation Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0045087 innate immune response Biological Process
KEGG gene cross-reference
ath:AT1G09970
ath:AT1G28440
ath:AT4G28490
ath:AT5G65700
ath:AT5G65710
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.873
Rank 1 · TkA07G045610 · TK1151
Endoplasmic reticulum0.083
Rank 2 · TkA07G045610 · TK1151
Cytoplasm0.061
Rank 3 · TkA07G045610 · TK1151
Nucleus0.033
Rank 4 · TkA07G045610 · TK1151
Lysosome / Vacuole0.030
Rank 5 · TkA07G045610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_219-60 aa
PF29594LRR_SKP267-122 aa
PF00560LRR_170-88 aa
PF25013LRR_Zer-171-151 aa
PF12799LRR_472-104 aa
PF13855LRR_880-125 aa
PF23211LRR_LRWD182-149 aa
PF23598LRR_1485-194 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G045610PF08263LRRNT_219606.4e-1246.3
TkA07G045610PF29594LRR_SKP2671225.7e-0523.2
TkA07G045610PF00560LRR_170882.4e-51161.3
TkA07G045610PF25013LRR_Zer-1711512e-0525.5
TkA07G045610PF12799LRR_4721043e-2691.6
TkA07G045610PF13855LRR_8801254.2e-32110.4
TkA07G045610PF23211LRR_LRWD1821490.0215.3
TkA07G045610PF23598LRR_14851941.8e-2486.9
TkA07G045610PF00560LRR_1911122.4e-51161.3
TkA07G045610PF13855LRR_8911494.2e-32110.4
TkA07G045610PF24758LRR_At5g56370931481.4e-0938.7
TkA07G045610PF25372LRR_FBXL151061480.03513.2
TkA07G045610PF23952LRR_EndoS1061470.710.9
TkA07G045610PF13516LRR_61121234.58.3
TkA07G045610PF00560LRR_11141362.4e-51161.3
TkA07G045610PF12799LRR_41141543e-2691.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SGP2Arabidopsis thalianasp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL172.100%Swiss-ProtLow
P47735Arabidopsis thalianasp|P47735|RLK5_ARATH Receptor-like protein kinase 562.000%Swiss-ProtLow
O49545Arabidopsis thalianasp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM148.300%Swiss-ProtLow
Q9M2Z1Arabidopsis thalianasp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM245.700%Swiss-ProtLow
C0LGX3Arabidopsis thalianasp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL247.000%Swiss-ProtLow

JBrowse

View in Genome Browser