LXL04_027291 | RubberDandelionOmics

Gene overview

LXL04_027291

Reference: OH-1004 Chr: Chr06 Coordinates: 12631385-12635123 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2994 bp · LXL04_027291|LXL04_027291|OH1004|cDNA

ATGTCACGCTCTCTCTGTTGTGTTTTGTTATTCTTGATGCCGTTTGGTCTTTGTTTGAATCAAGAGGGGAGTTATCTGCAACAGATGAAGCTTGGATTTGATGACCCAGATGGGTTTTTCGCCGACTGGAATGATGCCGCCGGTGATACCCCTTGTCATTGGACCGGTGTTACTTGTTCTGAACCGGGAAGTGGGTTTGTTGTCGGTGTTGATTTATCAAATGCTAATGTTGCCGGTCCTTTTCCGTCTGTTCTGTGCCG...

CDS

Download CDS FASTA

2994 bp · LXL04_027291|LXL04_027291|OH1004|CDS

ATGTCACGCTCTCTCTGTTGTGTTTTGTTATTCTTGATGCCGTTTGGTCTTTGTTTGAATCAAGAGGGGAGTTATCTGCAACAGATGAAGCTTGGATTTGATGACCCAGATGGGTTTTTCGCCGACTGGAATGATGCCGCCGGTGATACCCCTTGTCATTGGACCGGTGTTACTTGTTCTGAACCGGGAAGTGGGTTTGTTGTCGGTGTTGATTTATCAAATGCTAATGTTGCCGGTCCTTTTCCGTCTGTTCTGTGCCG...

Protein

Download Protein FASTA

997 aa · LXL04_027291|LXL04_027291|OH1004|PROTEIN

MSRSLCCVLLFLMPFGLCLNQEGSYLQQMKLGFDDPDGFFADWNDAAGDTPCHWTGVTCSEPGSGFVVGVDLSNANVAGPFPSVLCRLTGLKFISLYNNSINGTLSDDLSTCRSLVHLNLAQNLLTGKLPHSLSELPELKYLDLTGNNFSGDIPASFGLFQKLEVISLVDNLIDGKIPAELGNVSTLKQLNLSYNPFSSGQIPPELGNLTNLEVLWLTGCSLIGQIPESLGRLSKLVDLDLAINKLTGPVPSSLTELSNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027291`
TK1151 ID	TkA07G045610
OH-1004 ID	LXL04_027291
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027291

Location Chr06:12631385-12635123 (+)

Description Similar to HSL1: Receptor-like protein kinase HSL1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28440`	Receptor-like protein kinase HSL1.	No verified direct reference in this release
`At4g28490`	Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates that controls floral organ abscission.	No verified direct reference in this release
`At5g65710`	Receptor-like serine/threonine-kinase acting on substrates that controls floral organ abscission.	No verified direct reference in this release
`At1g09970`	Plays a role in pattern-triggered immunity (PTI) signaling induced by pathogen-associated molecular patterns (PAMPs).	RLK7, a leucine-rich repeat receptor-like kinase, is required for proper germination speed and tolerance to oxidative stress in Arabidopsis thaliana.2010 · DOI: 10.1007/s00425-010-1260-4 The secreted peptide PIP1 amplifies immunity through receptor-like kinase 7.2014 · DOI: 10.1371/journal.ppat.1004331
`At5g65700`	LRR-rich receptor-like kinase (LRR-RLK) that, similarly to CLV1 and BAM3, participates in the detection of the CLAVATA-family peptides (e.g. CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and of PBL34, PBL35 and PBL36.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027291 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0010227 floral organ abscission Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0030154 cell differentiation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0045087 innate immune response Biological Process

KEGG gene cross-reference

ath:AT1G09970

ath:AT1G28440

ath:AT4G28490

ath:AT5G65700

ath:AT5G65710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.873

Rank 1 · LXL04_027291 · OH-1004

Endoplasmic reticulum0.083

Rank 2 · LXL04_027291 · OH-1004

Cytoplasm0.060

Rank 3 · LXL04_027291 · OH-1004

Nucleus0.033

Rank 4 · LXL04_027291 · OH-1004

Lysosome / Vacuole0.030

Rank 5 · LXL04_027291 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_219-60 aa

PF23598.2LRR_1485-194 aa

PF13855.13LRR_891-149 aa

PF12799.14LRR_4114-154 aa

PF23598.2LRR_14180-347 aa

PF12799.14LRR_4186-227 aa

PF23598.2LRR_14455-552 aa

PF13855.13LRR_8499-558 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027291	`PF08263.18`	LRRNT_2	19	60	6.4e-12	46.3
LXL04_027291	`PF23598.2`	LRR_14	85	194	3.5e-24	85.9
LXL04_027291	`PF13855.13`	LRR_8	91	149	7.9e-32	109.5
LXL04_027291	`PF12799.14`	LRR_4	114	154	3e-26	91.6
LXL04_027291	`PF23598.2`	LRR_14	180	347	3.5e-24	85.9
LXL04_027291	`PF12799.14`	LRR_4	186	227	3e-26	91.6
LXL04_027291	`PF23598.2`	LRR_14	455	552	3.5e-24	85.9
LXL04_027291	`PF13855.13`	LRR_8	499	558	7.9e-32	109.5
LXL04_027291	`PF12799.14`	LRR_4	499	535	3e-26	91.6
LXL04_027291	`PF00069.32`	Pkinase	688	960	1.2e-41	143.6
LXL04_027291	`PF07714.24`	PK_Tyr_Ser-Thr	688	963	2.8e-36	125.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGP2`	Arabidopsis thaliana	Receptor-like protein kinase HSL1	66.767%	Swiss-Prot	strong database homology
`P47735`	Arabidopsis thaliana	Receptor-like protein kinase 5	58.055%	Swiss-Prot	strong database homology
`C0LGX3`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase HSL2	44.933%	Swiss-Prot	moderate database homology
`F4I2N7`	Arabidopsis thaliana	Receptor-like protein kinase 7	39.378%	Swiss-Prot	moderate database homology
`O49545`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1	39.372%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card