Gene Card
Gene overview
cDNA / CDS / Protein Sequences
558 bp · TkA07G043810|TK1151|cDNA
ATGATTGCTGGAAAATGGTTCGATTTGGCTTCGCTGATGCTTATTTCGGCTGAGACCAATGACAATCTAATCTGGCATTTGTTTGTCCTTACCTTAGATCTCGAGTGCATCTTCACCATCATCTGCAATCTTGTCAAGAAGCCTGAAAGCCTTGATGAAATGTTAGAGATGGCAAAGCTAATATCCACAAAAGTTGCACAACAACCAAATGATAAGCCTGCTCTCCGATTAAAGCTTTTGTTCAATCTGTACAACCTGTT...
558 bp · TkA07G043810|TK1151|CDS
ATGATTGCTGGAAAATGGTTCGATTTGGCTTCGCTGATGCTTATTTCGGCTGAGACCAATGACAATCTAATCTGGCATTTGTTTGTCCTTACCTTAGATCTCGAGTGCATCTTCACCATCATCTGCAATCTTGTCAAGAAGCCTGAAAGCCTTGATGAAATGTTAGAGATGGCAAAGCTAATATCCACAAAAGTTGCACAACAACCAAATGATAAGCCTGCTCTCCGATTAAAGCTTTTGTTCAATCTGTACAACCTGTT...
Protein
Download Protein FASTA185 aa · TkA07G043810|TK1151|PROTEIN
MIAGKWFDLASLMLISAETNDNLIWHLFVLTLDLECIFTIICNLVKKPESLDEMLEMAKLISTKVAQQPNDKPALRLKLLFNLYNLLENPYSWFYVYINALKLALNGKVIEHIIPSFKKIDSFLKEWNLGVHDQRELFLTISNVLKEHKSSTKETFKFLTKYLATFPGDDAHGMGGKGRSCLHYH
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G043810 |
|---|---|
| TK1151 ID | TkA07G043810 |
| OH-1004 ID | LXL04_024185 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 86.000 |
| Protein coverage (%) | TK1151 94.054 / OH-1004 38.063Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G043810 |
|---|---|
| Location | Chr07:11629876-11630851 (+) |
| Description | Similar to eif3m: Eukaryotic translation initiation factor 3 subunit M |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0001732 formation of cytoplasmic translation initiation complex Biological Process GO:0002183 cytoplasmic translational initiation Biological Process GO:0006413 translational initiation Biological Process GO:0005829 cytosol Cellular Component GO:0005852 eukaryotic translation initiation factor 3 complex Cellular Component GO:0016282 eukaryotic 43S preinitiation complex Cellular Component GO:0033290 eukaryotic 48S preinitiation complex Cellular Component GO:0071541 eukaryotic translation initiation factor 3 complex, eIF3m Cellular Component GO:0003743 translation initiation factor activity Molecular Function GO:0031369 translation initiation factor binding Molecular Function |
| KEGG gene cross-reference | bta:515543 ddi:DDB_G0287005 gga:421602 hsa:10480 pon:100173112 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF26779HEAT_NCAPD3_2106-156 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G043810 | PF26779 | HEAT_NCAPD3_2 | 106 | 156 | 0.0093 | 16.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.