Gene Card
Gene overview
cDNA / CDS / Protein Sequences
636 bp · TkA07G020580|TK1151|cDNA
ATGGATAAAGAAGGAAAGACTCCTCTCATATTGGCTTCCATGAGTCCACAGCTATATGATGTTGCAAAAACCCTAATAAAATTGGGTGCCAATGTGAACGCCTATCGTCCAGGTCGCCATGCTGGAACTCCTCTCCATCATGCTGCAAAAAGAGGCCTAGAACAGATGGTTAAACTGCTTCTTTCACATGGTGCTAATGCCTTGGTGATGAACGATGACTGTCAAACTGCACTTGATGTTGCAAGACTCAAAGGATATAA...
636 bp · TkA07G020580|TK1151|CDS
ATGGATAAAGAAGGAAAGACTCCTCTCATATTGGCTTCCATGAGTCCACAGCTATATGATGTTGCAAAAACCCTAATAAAATTGGGTGCCAATGTGAACGCCTATCGTCCAGGTCGCCATGCTGGAACTCCTCTCCATCATGCTGCAAAAAGAGGCCTAGAACAGATGGTTAAACTGCTTCTTTCACATGGTGCTAATGCCTTGGTGATGAACGATGACTGTCAAACTGCACTTGATGTTGCAAGACTCAAAGGATATAA...
Protein
Download Protein FASTA211 aa · TkA07G020580|TK1151|PROTEIN
MDKEGKTPLILASMSPQLYDVAKTLIKLGANVNAYRPGRHAGTPLHHAAKRGLEQMVKLLLSHGANALVMNDDCQTALDVARLKGYNNVERAIENHICLFSGWLQELYGPRFLELLAPQLLSRKVWVVILPCGARKLTKPFKLELAIYSGLQDAKPQSLLPLWKVNMDEPNFNQPDPIVILSSSNIPRRWRRRRCILHSQVRRKFIELKSD
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G020580 |
|---|---|
| TK1151 ID | TkA07G020580 |
| OH-1004 ID | LXL04_023095 |
| Relationship / confidence | Multi Candidate From Tk1151 / Complex relationship |
| Protein identity (%) | 93.800 |
| Protein coverage (%) | TK1151 98.578 / OH-1004 45.815Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G020580 | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:5561400-5562496 (+) | |||||||||||||||
| Description | Similar to XBAT35: Putative E3 ubiquitin-protein ligase XBAT35 | |||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| |||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||||||||
| GO annotations (OH1004 source) | GO:0006457 protein folding Biological Process GO:0009791 post-embryonic development Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0016567 protein ubiquitination Biological Process GO:0042742 defense response to bacterium Biological Process GO:0043067 regulation of programmed cell death Biological Process GO:0045036 protein targeting to chloroplast Biological Process GO:0070417 cellular response to cold Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005886 plasma membrane Cellular Component | |||||||||||||||
| KEGG gene cross-reference | ath:AT3G23280 ath:AT4G14365 ath:AT4G35450 dosa:Os07g0446100 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12796Ank_22-34 aaPF13637Ank_42-26 aaPF13857Ank_52-12 aaPF00023Ank5-34 aaPF13606Ank_35-34 aaPF23745ANK_LRRK219-81 aaPF13637Ank_420-61 aaPF13857Ank_525-81 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G020580 | PF12796 | Ank_2 | 2 | 34 | 2.6e-12 | 47.9 |
| TkA07G020580 | PF13637 | Ank_4 | 2 | 26 | 1.2e-09 | 38.9 |
| TkA07G020580 | PF13857 | Ank_5 | 2 | 12 | 2.7e-08 | 34.7 |
| TkA07G020580 | PF00023 | Ank | 5 | 34 | 3.8e-14 | 52.7 |
| TkA07G020580 | PF13606 | Ank_3 | 5 | 34 | 6e-09 | 36.0 |
| TkA07G020580 | PF23745 | ANK_LRRK2 | 19 | 81 | 0.2 | 12.2 |
| TkA07G020580 | PF13637 | Ank_4 | 20 | 61 | 1.2e-09 | 38.9 |
| TkA07G020580 | PF13857 | Ank_5 | 25 | 81 | 2.7e-08 | 34.7 |
| TkA07G020580 | PF00023 | Ank | 43 | 71 | 3.8e-14 | 52.7 |
| TkA07G020580 | PF12796 | Ank_2 | 43 | 89 | 2.6e-12 | 47.9 |
| TkA07G020580 | PF13606 | Ank_3 | 43 | 67 | 6e-09 | 36.0 |
| TkA07G020580 | PF13637 | Ank_4 | 45 | 85 | 1.2e-09 | 38.9 |
| TkA07G020580 | PF00023 | Ank | 75 | 86 | 3.8e-14 | 52.7 |
| TkA07G020580 | PF13606 | Ank_3 | 75 | 95 | 6e-09 | 36.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q4FE47 | Arabidopsis thaliana | sp|Q4FE47|XB35_ARATH Putative E3 ubiquitin-protein ligase XBAT35 | 67.300% | Swiss-Prot | High |
Q9FPH0 | Arabidopsis thaliana | sp|Q9FPH0|XB34_ARATH Putative E3 ubiquitin-protein ligase XBAT34 | 61.000% | Swiss-Prot | High |
Q7XI08 | Oryza sativa subsp. japonica | sp|Q7XI08|XB34_ORYSJ Probable E3 ubiquitin-protein ligase XBOS34 | 60.200% | Swiss-Prot | High |