TkA07G010200 | RubberDandelionOmics

Gene overview

TkA07G010200

Reference: TK1151 Chr: Chr07 Coordinates: 2790185-2793151 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1011 bp · TkA07G010200|TK1151|cDNA

ATGGAGGTCCTGAGATCACCGTTGTCCGCCGCGCAAAAAGGGAAACTGATTTCTGCAGGCTACACTTCCATTGATTTGCTTTCCTCAGTTTCTCCTTCCCATCTTGCACTAGAACTGAAGATTTCAGAATCCGAGGCACTTGAAATTTTAAACACTATATCAGATAGTAATTCAGAAACGAAAAGTAGCAGTTGCAGTATTGTTAAAGGTGCACAAAGTGCATGGGATATGCTGCAAGAAGAGGAAACCCTTGTACGTAT...

CDS

Download CDS FASTA

1011 bp · TkA07G010200|TK1151|CDS

ATGGAGGTCCTGAGATCACCGTTGTCCGCCGCGCAAAAAGGGAAACTGATTTCTGCAGGCTACACTTCCATTGATTTGCTTTCCTCAGTTTCTCCTTCCCATCTTGCACTAGAACTGAAGATTTCAGAATCCGAGGCACTTGAAATTTTAAACACTATATCAGATAGTAATTCAGAAACGAAAAGTAGCAGTTGCAGTATTGTTAAAGGTGCACAAAGTGCATGGGATATGCTGCAAGAAGAGGAAACCCTTGTACGTAT...

Protein

Download Protein FASTA

336 aa · TkA07G010200|TK1151|PROTEIN

MEVLRSPLSAAQKGKLISAGYTSIDLLSSVSPSHLALELKISESEALEILNTISDSNSETKSSSCSIVKGAQSAWDMLQEEETLVRITTSSSDFDNILGGGISCKEVTEIGGVPGIVNVQIPYDYGGLGGKAIYIDTEGSFMVERALQIAEACGDDMAEYSRLYHKGSSHFHEVKMQPKDFLENIFYFRVCSYTEQIALINYLDKFITDHKDVKVVIIDSITFHFRQDFDDMALRTRLLSGMALKLMKLAKNFGVAVVVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G010200`
TK1151 ID	TkA07G010200
OH-1004 ID	LXL04_026841
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G010200

Location Chr07:2790185-2793151 (-)

Description Similar to RAD51C: DNA repair protein RAD51 homolog 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45280`	Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026841 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000707 meiotic DNA recombinase assembly Biological Process

GO:0000722 telomere maintenance via recombination Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0007062 sister chromatid cohesion Biological Process

GO:0007066 female meiosis sister chromatid cohesion Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0007140 male meiotic nuclear division Biological Process

GO:0007141 male meiosis I Biological Process

GO:0007143 female meiotic nuclear division Biological Process

GO:0007283 spermatogenesis Biological Process

KEGG gene cross-reference

ath:AT2G45280

cge:100689078

ddi:DDB_G0284507

hsa:5889

mmu:114714

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.596

Rank 1 · TkA07G010200 · TK1151

Cytoplasm0.445

Rank 2 · TkA07G010200 · TK1151

Mitochondrion0.072

Rank 3 · TkA07G010200 · TK1151

Peroxisome0.035

Rank 4 · TkA07G010200 · TK1151

Cell membrane0.028

Rank 5 · TkA07G010200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08423Rad5182-156 aa

PF06745ATPase91-267 aa

PF13481AAA_25130-262 aa

PF08423Rad51175-325 aa

PF17365DUF5390195-263 aa

PF03796DnaB_C207-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G010200	`PF08423`	Rad51	82	156	2.4e-34	119.4
TkA07G010200	`PF06745`	ATPase	91	267	6.5e-05	23.1
TkA07G010200	`PF13481`	AAA_25	130	262	0.04	14.3
TkA07G010200	`PF08423`	Rad51	175	325	2.4e-34	119.4
TkA07G010200	`PF17365`	DUF5390	195	263	0.087	14.0
TkA07G010200	`PF03796`	DnaB_C	207	265	0.013	15.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXF0`	Arabidopsis thaliana	sp\|Q8GXF0\|RA51C_ARATH DNA repair protein RAD51 homolog 3	67.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card