TkA07G008120 | RubberDandelionOmics

Gene overview

TkA07G008120

Reference: TK1151 Chr: Chr07 Coordinates: 2240444-2240982 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

363 bp · TkA07G008120|TK1151|cDNA

GGCATTAAGATCAATAATTTGGATTTAATAAAAGAAAGGGGTTATAGTCTATCTCGAATCTCTTCACGTGCCATTGAAGCATTCTTGATTCAGATACTGAAAACTGGTTTCTTTAATGGGGATCCTCATCTTTCAATTGATTCTGATGAATCATTAATTTACTATGCTTTTGGCATGATGGGGGAGATTAAATCCTTCACAAGAGAAAGATTAATGGATCTTTTTTATGCAAATTATGAAAAAGATGCCAAAAAGGTTAT...

CDS

Download CDS FASTA

363 bp · TkA07G008120|TK1151|CDS

GGCATTAAGATCAATAATTTGGATTTAATAAAAGAAAGGGGTTATAGTCTATCTCGAATCTCTTCACGTGCCATTGAAGCATTCTTGATTCAGATACTGAAAACTGGTTTCTTTAATGGGGATCCTCATCTTTCAATTGATTCTGATGAATCATTAATTTACTATGCTTTTGGCATGATGGGGGAGATTAAATCCTTCACAAGAGAAAGATTAATGGATCTTTTTTATGCAAATTATGAAAAAGATGCCAAAAAGGTTAT...

Protein

Download Protein FASTA

120 aa · TkA07G008120|TK1151|PROTEIN

GIKINNLDLIKERGYSLSRISSRAIEAFLIQILKTGFFNGDPHLSIDSDESLIYYAFGMMGEIKSFTRERLMDLFYANYEKDAKKVMKSLISLEALQPTGDIMFDKSCSTSTYRRHDSSM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G008120`
TK1151 ID	TkA07G008120
OH-1004 ID	LXL04_024259
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.600
Protein coverage (%)	TK1151 99.167 / OH-1004 70.833 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G008120

Location Chr07:2240444-2240982 (+)

Description Similar to ABC1K7: Protein ACTIVITY OF BC1 COMPLEX KINASE 7, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07700`	Involved in resistance to oxidative stress.	Loss of the Atypical Kinases ABC1K7 and ABC1K8 Changes the Lipid Composition of the Chloroplast Membrane.2015 · DOI: 10.1093/pcp/pcv046

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024259 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0010150 leaf senescence Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0046467 membrane lipid biosynthetic process Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:1901031 regulation of response to reactive oxygen species Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT3G07700

ath:AT5G64940

syn:sll0005

syn:sll0095

syn:sll1770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.630

Rank 1 · TkA07G008120 · TK1151

Cytoplasm0.089

Rank 2 · TkA07G008120 · TK1151

Mitochondrion0.078

Rank 3 · TkA07G008120 · TK1151

Lysosome / Vacuole0.047

Rank 4 · TkA07G008120 · TK1151

Endoplasmic reticulum0.034

Rank 5 · TkA07G008120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03109ABC11-89 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G008120	`PF03109`	ABC1	1	89	1.2e-17	64.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B9DGY1`	Arabidopsis thaliana	sp\|B9DGY1\|AB1K7_ARATH Protein ACTIVITY OF BC1 COMPLEX KINASE 7, chloroplastic	73.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card