Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2097 bp · TkA07G004870|TK1151|cDNA
TGATCATAGTCTCTTGACTCTTAGTTCTGCTTGATCATCGATTCCAGAGACTGTGAAGTAGAAAGCAGAATCTCACTGCATATCCAAGCGAATTCCATGGGCGACGATCATAAACCACTGTCACAGGATCACATCGATATTGGTGAGCCAGAGACTCATAACTGCGTGATCAAGCTGAGAGTAAACCCTAAGAAGCGCAGGGAGAAAGTTTTTGTTGGTTGTGGTGCTGGTTTTGGAGGTGATAGACCATTGGCGGCTCT...
5010 bp · TkA07G004870|TK1151|CDS
ATGTGGAGGAAGACGGTGGCTCGATCGACAGCGGTGGTGGAAAACCTCCGGAAGTCACGGAGCTTTTCTATCGCGGCCTCGGTGTCTCCGATCCCTGGACCTTGTATTGTTCATAAGCGCGGAGCGGATATTCTCCATGATCCTTGGTTTAACAAGGATACTGGATTTCCTTTGACAGAAAGAGACCGACTTGGTCTTCGTGGTCTCCTTCCACCTCGTGTCATATCTTTTGAACAACAGTATGAGCGTTTCATGGATTC...
Protein
Download Protein FASTA1669 aa · TkA07G004870|TK1151|PROTEIN
MWRKTVARSTAVVENLRKSRSFSIAASVSPIPGPCIVHKRGADILHDPWFNKDTGFPLTERDRLGLRGLLPPRVISFEQQYERFMDSYRSLEKNTECQPYSVVSLAKWRILNRLHDRNETLYYKVLIDNIKDFAPVIYTPTVGLVCQNYSGLFRRPRGMYFSAKDKGEMMSMIYNWPAPEVDMVVLTDGSRILGLGDLGVQGIGIPIGKLDMYVAAAGINPQRVLPIMLDVGTNNQKLLEDPLYLGLREQRLEGEEYISV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G004870 |
|---|---|
| TK1151 ID | TkA07G004870 |
| OH-1004 ID | LXL04_022674 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 83.000 |
| Protein coverage (%) | TK1151 35.231 / OH-1004 96.242Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G004870 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:1344093-1364020 (-) | |||||||||
| Description | Similar to NAD-dependent malic enzyme 59 kDa isoform, mitochondrial | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006108 malate metabolic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005829 cytosol Cellular Component GO:0004471 malate dehydrogenase (decarboxylating) (NAD+) activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0042803 protein homodimerization activity Molecular Function GO:0046872 metal ion binding Molecular Function GO:0050897 cobalt ion binding Molecular Function GO:0051287 NAD binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G13560 ath:AT4G00570 sot:102598070 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00390malic115-295 aaPF03949Malic_M305-567 aaPF12637TSCPD387-416 aaPF03332PMM399-420 aaPF12637TSCPD593-607 aaPF01603B56646-701 aaPF03949Malic_M814-860 aaPF08282Hydrolase_3816-1009 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G004870 | PF00390 | malic | 115 | 295 | 3.8e-74 | 249.2 |
| TkA07G004870 | PF03949 | Malic_M | 305 | 567 | 5.6e-84 | 282.2 |
| TkA07G004870 | PF12637 | TSCPD | 387 | 416 | 0.048 | 14.7 |
| TkA07G004870 | PF03332 | PMM | 399 | 420 | 7e-109 | 363.5 |
| TkA07G004870 | PF12637 | TSCPD | 593 | 607 | 0.048 | 14.7 |
| TkA07G004870 | PF01603 | B56 | 646 | 701 | 2.2e-12 | 47.4 |
| TkA07G004870 | PF03949 | Malic_M | 814 | 860 | 5.6e-84 | 282.2 |
| TkA07G004870 | PF08282 | Hydrolase_3 | 816 | 1009 | 4.2e-05 | 24.1 |
| TkA07G004870 | PF03332 | PMM | 834 | 1047 | 7e-109 | 363.5 |
| TkA07G004870 | PF07287 | AtuA | 1085 | 1501 | 1.7e-99 | 334.3 |
| TkA07G004870 | PF23544 | AtuA_ferredoxin | 1562 | 1665 | 6.7e-42 | 143.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.