TkA07G004560 | RubberDandelionOmics

Gene overview

TkA07G004560

Reference: TK1151 Chr: Chr07 Coordinates: 1215337-1219242 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1127 bp · TkA07G004560|TK1151|cDNA

GAAGAACAAAGCTTCGCGAAAGACAACGAAGAGCAATCACTGCAAAAATCCTGGCAGGTCTTAGAAGACATGGAAACTACAATCTTAGGGTTAGAGCTGACATCAATGATGTGATTGCAGCATTAGCAAGAGAAGCTGGTTGGGTTGTTCTTCCTGATGGAACCACTTTTCCATCAAGGTCACAAGGTGTGAGACCTTCAACTACAATGGCAGCAACTTCATCCACCTCACTGCCATGTCAGCAGAATCAAGCTCCTGTA...

CDS

Download CDS FASTA

780 bp · TkA07G004560|TK1151|CDS

ATGTCAGCAGAATCAAGCTCCTGTAAGAGGCATTCATCTGCATGTCCAATTGAAATGGATAATGATGGATACCAAATGAAAGGTCTTTATGTTCCTTCTTCTGGTTATGATGTGTCATCAAGTGGGAGATCTCAGTCTTCTCATATGCTGGGAGTTGAAGTTGATAATCAAGATGATCCACTTGTTGCAGGCAGGCAGGTGGTTGACATGCCTTCAAAGTTACAAGAACGAGATTTTGCGGGTACTCCTTATGTTCCTGT...

Protein

Download Protein FASTA

259 aa · TkA07G004560|TK1151|PROTEIN

MSAESSSCKRHSSACPIEMDNDGYQMKGLYVPSSGYDVSSSGRSQSSHMLGVEVDNQDDPLVAGRQVVDMPSKLQERDFAGTPYVPVYVLLPLGVINMKCEVVDADGLLNQLRVLKSINVDGVMVDCWWGIVEAHAPQEYNWKGYKRLFQMVRDLKLKLQVVMSFHECGGNVGDDVCIPLPHWVAEIGRSNPDIYFTDRSGRRNPECLSFGIDKERVLRGRTASEVYFDYMRSFRVEFDELFVDGVVSMVEMGWVLVGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G004560`
TK1151 ID	TkA07G004560
OH-1004 ID	LXL04_026730
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	71.800
Protein coverage (%)	TK1151 72.587 / OH-1004 35.094 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G004560

Location Chr07:1215337-1219242 (+)

Description Similar to BAM2: Beta-amylase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45880`	Beta-amylase 7.	No verified direct reference in this release
`At4g00490`	Low beta-amylase activity.	No verified direct reference in this release
`At5g45300`	Beta-amylase 8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026730 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000272 polysaccharide catabolic process Biological Process

GO:0005983 starch catabolic process Biological Process

GO:0048831 regulation of shoot system development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0016161 beta-amylase activity Molecular Function

GO:0016798 hydrolase activity, acting on glycosyl bonds Molecular Function

KEGG gene cross-reference

ath:AT2G45880

ath:AT4G00490

ath:AT5G45300

gmx:547931

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.340

Rank 1 · TkA07G004560 · TK1151

Nucleus0.301

Rank 2 · TkA07G004560 · TK1151

Plastid0.128

Rank 3 · TkA07G004560 · TK1151

Mitochondrion0.102

Rank 4 · TkA07G004560 · TK1151

Cell membrane0.101

Rank 5 · TkA07G004560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01373Glyco_hydro_1488-253 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G004560	`PF01373`	Glyco_hydro_14	88	253	5.9e-53	181.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80831`	Arabidopsis thaliana	sp\|O80831\|BAM7_ARATH Beta-amylase 7	65.700%	Swiss-Prot	High
`O65258`	Arabidopsis thaliana	sp\|O65258\|BAM2_ARATH Beta-amylase 2, chloroplastic	67.000%	Swiss-Prot	High
`Q9FH80`	Arabidopsis thaliana	sp\|Q9FH80\|BAM8_ARATH Beta-amylase 8	57.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card