TkA07G004040 | RubberDandelionOmics

Gene overview

TkA07G004040

Reference: TK1151 Chr: Chr07 Coordinates: 1052752-1057568 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2176 bp · TkA07G004040|TK1151|cDNA

AGAACAATATTTCTGCAGGGTTTATCCTCTTCCTCTCACTCTAAACTAGAGAGAGAGTCTGTGAAAGTATGGTGTAAATTCTGCAATAAATTATTCGAATTCCAGATTTGTGCAGCTCAGCTGGTCAGAAATGGCCATCGGCGCCGTTATTTCTCACCGGAACTTCACATCCTTCATCAGCTCAGGTAAAATTCATAAACCTGAACAATCCACAACATATCAGAGATCAGATAAATTAAGCTCCATGTATTCAACAAATC...

CDS

Download CDS FASTA

1716 bp · TkA07G004040|TK1151|CDS

ATGGCCATCGGCGCCGTTATTTCTCACCGGAACTTCACATCCTTCATCAGCTCAGGTAAAATTCATAAACCTGAACAATCCACAACATATCAGAGATCAGATAAATTAAGCTCCATGTATTCAACAAATCTATATAGTCTAAAGAAGATCCACCTCATTTCCGGATACTTAAACACCACATCTTCTCATGGTCTTCATCTTCCAACAATCCCACAAGAAACCAAAAAGTTCCAAATCAGAAACCATACACAAATAGCAAA...

Protein

Download Protein FASTA

571 aa · TkA07G004040|TK1151|PROTEIN

MAIGAVISHRNFTSFISSGKIHKPEQSTTYQRSDKLSSMYSTNLYSLKKIHLISGYLNTTSSHGLHLPTIPQETKKFQIRNHTQIAKCRWIKPVVQLKHNSISNRKTLQPRSSINRIRANYKSEDYDDVAGPDIVSSPEGGGASEAVLVGEIKETNQVPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMSKEFGWNSATVGLIQSSFFWGYLLTQIVGGIWADKIGGKQVLGFGVIWWSVATILTPIAAKISLPFLLVMR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G004040`
TK1151 ID	TkA07G004040
OH-1004 ID	LXL04_000615
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	81.200
Protein coverage (%)	TK1151 72.680 / OH-1004 77.425 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G004040

Location Chr07:1052752-1057568 (-)

Description Similar to ANTR1: Sodium-dependent phosphate transport protein 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00370`	Inorganic phosphate and probable anion transporter.	AtPHT4;4 is a chloroplast-localized ascorbate transporter in Arabidopsis.2015 · DOI: 10.1038/ncomms6928
`At2g29650`	Specific for inorganic phosphate transport across the thylakoid membrane in a sodium dependent manner.	Arabidopsis ANTR1 is a thylakoid Na+-dependent phosphate transporter: functional characterization in Escherichia coli.2008 · DOI: 10.1074/jbc.m709371200
`At2g38060`	Inorganic phosphate and probable anion transporter.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0570400`	Probable anion transporter.	No verified direct reference in this release
`Os01g0279700`	Probable anion transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000615 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006811 monoatomic ion transport Biological Process

GO:0006814 sodium ion transport Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009624 response to nematode Biological Process

GO:0010028 xanthophyll cycle Biological Process

GO:0015882 L-ascorbic acid transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

KEGG gene cross-reference

ath:AT2G29650

ath:AT2G38060

ath:AT4G00370

dosa:Os01g0279700

dosa:Os09g0570400

osa:4326905

osa:4347913

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.971

Rank 1 · TkA07G004040 · TK1151

Mitochondrion0.030

Rank 2 · TkA07G004040 · TK1151

Peroxisome0.022

Rank 3 · TkA07G004040 · TK1151

Cytoplasm0.021

Rank 4 · TkA07G004040 · TK1151

Nucleus0.018

Rank 5 · TkA07G004040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690MFS_1168-530 aa

PF06779MFS_4187-327 aa

PF03092BT1249-472 aa

PF06779MFS_4381-446 aa

PF12420DUF3671387-414 aa

PF03092BT1452-559 aa

PF07690MFS_1515-560 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G004040	`PF07690`	MFS_1	168	530	5.9e-60	203.7
TkA07G004040	`PF06779`	MFS_4	187	327	0.00017	21.8
TkA07G004040	`PF03092`	BT1	249	472	0.14	11.6
TkA07G004040	`PF06779`	MFS_4	381	446	0.00017	21.8
TkA07G004040	`PF12420`	DUF3671	387	414	0.13	12.5
TkA07G004040	`PF03092`	BT1	452	559	0.14	11.6
TkA07G004040	`PF07690`	MFS_1	515	560	5.9e-60	203.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GX78`	Arabidopsis thaliana	sp\|Q8GX78\|ANTR2_ARATH Ascorbate transporter, chloroplastic	83.200%	Swiss-Prot	High
`O82390`	Arabidopsis thaliana	sp\|O82390\|ANTR1_ARATH Sodium-dependent phosphate transport protein 1, chloroplastic	80.200%	Swiss-Prot	High
`Q7XJR2`	Arabidopsis thaliana	sp\|Q7XJR2\|ANTR3_ARATH Probable anion transporter 3, chloroplastic	40.500%	Swiss-Prot	Medium
`Q652N5`	Oryza sativa subsp. japonica	sp\|Q652N5\|PHT44_ORYSJ Probable anion transporter 4, chloroplastic	68.200%	Swiss-Prot	High
`Q9SDI4`	Oryza sativa subsp. japonica	sp\|Q9SDI4\|PHT41_ORYSJ Probable anion transporter 1, chloroplastic	82.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card