TkA07G002910 | RubberDandelionOmics

Gene overview

TkA07G002910

Reference: TK1151 Chr: Chr07 Coordinates: 786185-801541 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1349 bp · TkA07G002910|TK1151|cDNA

CTTGTACAGAGAGACAAGAGTGAAGAAGCGTTACAACTTGCTCGGTTATCAGAAGAAAAGCCTCATTTTTCCCATTGCTTAGAGTGGCTTCTTTTTACAGTTTTTGAAGCCGAAATTTCCAGCCAAAATGCAAACAGAAATGAAAGACCTTCTCTTTTGGAGAAAACATGTGATTTAATAAAGAAGTTTCCGGAATATTTTGATGTTGTTGTTAGTGTGGCAAGAAAGACTGATGGTCGTCATTGGGCAGATCTCTTTAC...

CDS

Download CDS FASTA

2406 bp · TkA07G002910|TK1151|CDS

ATGGACACCCGACAGCTCAGCATTCGCAGTCGGATGGAAACAAAGAGGCCTCACAGTCTGGTCAATTTCGGCTGCCGTCTCATGTCCACAATCCGCCAAATCAGCCTAACATCCGCCACGTCATCGCCACCTGTCAAACAAAACCCCGAAACAAACTACGAACCGTTAATGACCGGGACCTCATTCACCCACTGGGACCCACACGGGTACAGACTCTACGCCATCGAGTCAAATTCCTCAGAGAGAATACTCTCCTTCTC...

Protein

Download Protein FASTA

801 aa · TkA07G002910|TK1151|PROTEIN

MDTRQLSIRSRMETKRPHSLVNFGCRLMSTIRQISLTSATSSPPVKQNPETNYEPLMTGTSFTHWDPHGYRLYAIESNSSERILSFSFGKCCLNRGVSGKTYVRQVIYGEDRLLVVQDMDELKLMHLNLPVSYISQNWPVCHVAASEDGMYLAVAGAHGLVLYDIRLNRWRFFGDVTQEQRITCTGLLWMGKIVVVCNYVEASDTYELLFYPRYHLDQSSLLYQKPLLAKPLVMDVYNDYLLVTYHPFDVHIFHVKLSGD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G002910`
TK1151 ID	TkA07G002910
OH-1004 ID	LXL04_026710
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.900
Protein coverage (%)	TK1151 97.129 / OH-1004 70.663 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G002910`
Location	Chr07:786185-801541 (-)
Description	Similar to RIC1: Guanine nucleotide exchange factor subunit RIC1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026710` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0003330 regulation of extracellular matrix constituent secretion Biological Process GO:0006886 intracellular protein transport Biological Process GO:0032483 regulation of Rab protein signal transduction Biological Process GO:0035418 protein localization to synapse Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process GO:0042177 negative regulation of protein catabolic process Biological Process GO:0043547 positive regulation of GTPase activity Biological Process GO:0050808 synapse organization Biological Process GO:0060078 regulation of postsynaptic membrane potential Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	cel:CELE_R06F6.8 dme:Dmel_CG9063 hsa:57589 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.500

Rank 1 · TkA07G002910 · TK1151

Nucleus0.279

Rank 2 · TkA07G002910 · TK1151

Golgi apparatus0.195

Rank 3 · TkA07G002910 · TK1151

Lysosome / Vacuole0.136

Rank 4 · TkA07G002910 · TK1151

Cell membrane0.100

Rank 5 · TkA07G002910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25440Beta-prop_RIC1_2nd110-438 aa

PF30566DUF8633310-333 aa

PF07064RIC1445-611 aa

PF30566DUF8633446-472 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G002910	`PF25440`	Beta-prop_RIC1_2nd	110	438	1.7e-84	284.6
TkA07G002910	`PF30566`	DUF8633	310	333	0.42	11.4
TkA07G002910	`PF07064`	RIC1	445	611	8.3e-51	172.7
TkA07G002910	`PF30566`	DUF8633	446	472	0.42	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card