TkA07G001810 | RubberDandelionOmics

Gene overview

TkA07G001810

Reference: TK1151 Chr: Chr07 Coordinates: 457963-459324 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1362 bp · TkA07G001810|TK1151|cDNA

ATGAAGGTAAGCATATCAAGAGGAATCCCTAAGTTTATCTTCCTATCGGGTATTTTTTCAATTTTTTGTGTTGTTTTATTTTCGAAATTTTACTCTTTCAACCCGTTTATCGTTCGGGATACTAAATGCGACTATGATTCTAATCCCCGTGTCACTTACCGCCCCGAAATCAAGATATTAGAAACGGTTATCAAAAAAATCGAGCAAGAGATCATCCATATTAAAGATTCCGACAACGATTCCTCGCACGCGTTAAGATA...

CDS

Download CDS FASTA

1362 bp · TkA07G001810|TK1151|CDS

ATGAAGGTAAGCATATCAAGAGGAATCCCTAAGTTTATCTTCCTATCGGGTATTTTTTCAATTTTTTGTGTTGTTTTATTTTCGAAATTTTACTCTTTCAACCCGTTTATCGTTCGGGATACTAAATGCGACTATGATTCTAATCCCCGTGTCACTTACCGCCCCGAAATCAAGATATTAGAAACGGTTATCAAAAAAATCGAGCAAGAGATCATCCATATTAAAGATTCCGACAACGATTCCTCGCACGCGTTAAGATA...

Protein

Download Protein FASTA

453 aa · TkA07G001810|TK1151|PROTEIN

MKVSISRGIPKFIFLSGIFSIFCVVLFSKFYSFNPFIVRDTKCDYDSNPRVTYRPEIKILETVIKKIEQEIIHIKDSDNDSSHALRYGSFLADIVGLIESAKFAENEVVGLSKCDINRSNPIHVSPDFFLMEEIRKYVRMKPNRLGKQNFMGANGTFTSIGHTCFSMKQELEEYMNYDVGDICNDDWKLAQRLMVHGCDPLPRRRCFSLAPRYYTKPFPIPKSLWSLPDDKNVRWSQYRCKNFACLASSKIGKGFFKCAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G001810`
TK1151 ID	TkA07G001810
OH-1004 ID	LXL04_026688
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.000
Protein coverage (%)	TK1151 96.909 / OH-1004 43.596 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G001810

Location Chr07:457963-459324 (-)

Description Similar to ATL68: RING-H2 finger protein ATL68

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29790`	Probable methyltransferase At1g29790.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026688 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009269 response to desiccation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0071465 cellular response to desiccation Biological Process

GO:1902075 cellular response to salt Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT2G46160

ath:AT3G61550

ghi:107922715

gmx:547837

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.632

Rank 1 · TkA07G001810 · TK1151

Endoplasmic reticulum0.133

Rank 2 · TkA07G001810 · TK1151

Cell membrane0.066

Rank 3 · TkA07G001810 · TK1151

Extracellular0.065

Rank 4 · TkA07G001810 · TK1151

Cytoplasm0.060

Rank 5 · TkA07G001810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141Methyltransf_29201-224 aa

PF03141Methyltransf_29298-401 aa

PF08241Methyltransf_11304-399 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G001810	`PF03141`	Methyltransf_29	201	224	9.9e-07	28.4
TkA07G001810	`PF03141`	Methyltransf_29	298	401	9.9e-07	28.4
TkA07G001810	`PF08241`	Methyltransf_11	304	399	0.0097	17.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWB7`	Arabidopsis thaliana	sp\|Q8RWB7\|PMT12_ARATH Probable methyltransferase At1g29790	37.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card