Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2673 bp · LXL04_026688|LXL04_026688|OH1004|cDNA
ATGTCCTCTGTATCACCTCCACCCCCATCACTAGCCGTACCCATTACTACCTTACCAACATCGGCCTCAGTTACGCCATCGCCATCGCACTTGGTTTCCTCGTCCTCTTCGCCACCCTCCTCCTCGCTTCGTACATCTGCCTCCGCCACCGTTACAGGTACCGGTACCAGCATCGCCATCATCACCAAAACCAAAACCCTAAGTATATGTATCTATGTTAGGCAAACACGTGACACGTGTACCACCAAATGCCACATTAC...
2673 bp · LXL04_026688|LXL04_026688|OH1004|CDS
ATGTCCTCTGTATCACCTCCACCCCCATCACTAGCCGTACCCATTACTACCTTACCAACATCGGCCTCAGTTACGCCATCGCCATCGCACTTGGTTTCCTCGTCCTCTTCGCCACCCTCCTCCTCGCTTCGTACATCTGCCTCCGCCACCGTTACAGGTACCGGTACCAGCATCGCCATCATCACCAAAACCAAAACCCTAAGTATATGTATCTATGTTAGGCAAACACGTGACACGTGTACCACCAAATGCCACATTAC...
Protein
Download Protein FASTA890 aa · LXL04_026688|LXL04_026688|OH1004|PROTEIN
MSSVSPPPPSLAVPITTLPTSASVTPSPSHLVSSSSSPPSSSLRTSASATVTGTGTSIAIITKTKTLSICIYVRQTRDTCTTKCHITTPTQPFTLEDMIVAGDMASLMDKAKQFVSNAVASMEKPEACVTDVDLKGVNLGSVTYLAKVKVTNPYSVSIPIGEIRYILKSFGSEIASGTIPDPGSLKGDEDTMLNIDMKVPHNILVTLVKDIAKDWDIDYELKIILVVDLPLIATYPPTSDNTHHHHHPALSPPSKWTSPP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_026688 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_026688 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:1400516-1411145 (-) | |||||||||
| Description | Similar to ATL68: RING-H2 finger protein ATL68 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009269 response to desiccation Biological Process GO:0016567 protein ubiquitination Biological Process GO:0071465 cellular response to desiccation Biological Process GO:1902075 cellular response to salt Biological Process GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G46160 ath:AT3G61550 ghi:107922715 gmx:547837 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03168.20LEA_2147-231 aaPF13639.13zf-RING_2389-431 aaPF17123.12zf-RING_11389-417 aaPF12678.14zf-rbx1393-431 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_026688 | PF03168.20 | LEA_2 | 147 | 231 | 5.5e-16 | 59.6 |
| LXL04_026688 | PF13639.13 | zf-RING_2 | 389 | 431 | 3.7e-11 | 43.8 |
| LXL04_026688 | PF17123.12 | zf-RING_11 | 389 | 417 | 1.5e-07 | 31.7 |
| LXL04_026688 | PF12678.14 | zf-rbx1 | 393 | 431 | 4.1e-07 | 30.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.