Gene Card
Gene overview
cDNA / CDS / Protein Sequences
432 bp · TkA06G480720|TK1151|cDNA
CTTAGGTCTCATCCAACAAGTCGCTTCCTGTACCTTAAAACAGTTATTGAAGTTCATTCAAAGGGCACCCTCAACTTCACTTGTCTAACAAAAGGACAAACCGGCCGACTACATCATTTCTTGCAAACAATTTCGGATTTCCCAAAGTTTTTACGTGAGAATCCACTTCACATAACTGATGAAATCACTGAGACGTATCTTGAGTTGCTATGTGAGTTTGAACCGAAGAGTGTCCTGAACTTCCTTGAGACATGTGAAAG...
432 bp · TkA06G480720|TK1151|CDS
CTTAGGTCTCATCCAACAAGTCGCTTCCTGTACCTTAAAACAGTTATTGAAGTTCATTCAAAGGGCACCCTCAACTTCACTTGTCTAACAAAAGGACAAACCGGCCGACTACATCATTTCTTGCAAACAATTTCGGATTTCCCAAAGTTTTTACGTGAGAATCCACTTCACATAACTGATGAAATCACTGAGACGTATCTTGAGTTGCTATGTGAGTTTGAACCGAAGAGTGTCCTGAACTTCCTTGAGACATGTGAAAG...
Protein
Download Protein FASTA144 aa · TkA06G480720|TK1151|PROTEIN
LRSHPTSRFLYLKTVIEVHSKGTLNFTCLTKGQTGRLHHFLQTISDFPKFLRENPLHITDEITETYLELLCEFEPKSVLNFLETCESYRVDHCLRLCQEHGIIDAAAFLLERVGDVGSALSFTLCDLLGKFHMLDAVAQSVLHD
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G480720 |
|---|---|
| TK1151 ID | TkA06G480720 |
| OH-1004 ID | LXL04_022537 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 14.953Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G480720 |
|---|---|
| Location | Chr06:119147830-119148331 (-) |
| Description | Similar to Vps8: Vacuolar protein sorting-associated protein 8 homolog |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006623 protein targeting to vacuole Biological Process GO:0006897 endocytosis Biological Process GO:0007032 endosome organization Biological Process GO:0016197 endosomal transport Biological Process GO:0034058 endosomal vesicle fusion Biological Process GO:0035542 regulation of SNARE complex assembly Biological Process GO:0005769 early endosome Cellular Component GO:0005770 late endosome Cellular Component GO:0033263 CORVET complex Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0043495 protein-membrane adaptor activity Molecular Function GO:0051020 GTPase binding Molecular Function |
| KEGG gene cross-reference | dme:Dmel_CG10144 hsa:23355 mmu:209018 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12816TPR_Vps87-25 aaPF23556TPR_Vps4156-124 aaPF28737VPS18_solenoid_2nd59-124 aaPF00637Clathrin61-121 aaPF12816TPR_Vps864-83 aaPF12816TPR_Vps888-112 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G480720 | PF12816 | TPR_Vps8 | 7 | 25 | 0.24 | 11.6 |
| TkA06G480720 | PF23556 | TPR_Vps41 | 56 | 124 | 1.9e-09 | 37.9 |
| TkA06G480720 | PF28737 | VPS18_solenoid_2nd | 59 | 124 | 0.00013 | 22.7 |
| TkA06G480720 | PF00637 | Clathrin | 61 | 121 | 0.00019 | 21.9 |
| TkA06G480720 | PF12816 | TPR_Vps8 | 64 | 83 | 0.24 | 11.6 |
| TkA06G480720 | PF12816 | TPR_Vps8 | 88 | 112 | 0.24 | 11.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.