TkA06G480070 | RubberDandelionOmics

Gene overview

TkA06G480070

Reference: TK1151 Chr: Chr06 Coordinates: 118961361-118962396 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

692 bp · TkA06G480070|TK1151|cDNA

AGATGGGCAAGTTCTATGAGCTCTTTGAAATGGATGCACATGTTGGAGCAAAAGAACTTGATTTGCAATATATGAAGGGAGACCAACCTCATTGTGGATTCCCAGAAAAGAACTTTGCAACAAATGTAGAGAAGTTGGCTTGCAAGGGTTACCGTGTTCTGGTAGTTGAGCAGACAGAGACACCTGATCAGCTTGATAGGCGTCGCAAAGAGTAGGGTTCTAAAGATAAGGTTGTGAAACGTGAAATATGTGGGGTAGTC...

CDS

Download CDS FASTA

405 bp · TkA06G480070|TK1151|CDS

ATGGTGGCAGCCAATCCGGATGCTTCTTACCTTTTTGCAGTTTCTGAAGCATCAGGAAACCAAGATGAACATGGTGATAGAATCTATGGTGTTTGTGTGCTTGATGTTGCTACAAGCAAGATCATGATAGGACAGTTTGAAGATGATTCAAAGTGCAGTGGATTGAGCTGTCTATTGTCCCAACTAAGACCAGTAGAAATCATAAAACCTATGAAATCACTGACCCCTGAAACCGAAAAAGTACTTGTGAGACAAACAAA...

Protein

Download Protein FASTA

135 aa · TkA06G480070|TK1151|PROTEIN

MVAANPDASYLFAVSEASGNQDEHGDRIYGVCVLDVATSKIMIGQFEDDSKCSGLSCLLSQLRPVEIIKPMKSLTPETEKVLVRQTKSPVINELIPLEEFWDAEKTTCEIKNIYKRISSQSSLNESMSINDCLPQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G480070`
TK1151 ID	TkA06G480070
OH-1004 ID	LXL04_022526
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 11.709 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G480070

Location Chr06:118961361-118962396 (-)

Description Similar to MCM7: DNA replication licensing factor MCM7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02070`	Component of the post-replicative DNA mismatch repair system (MMR).	Arabidopsis MutS homologs-AtMSH2, AtMSH3, AtMSH6, and a novel AtMSH7-form three distinct protein heterodimers with different specificities for mismatched DNA.2000 · DOI: 10.1105/tpc.12.6.991 Dissimilar mispair-recognition spectra of Arabidopsis DNA-mismatch-repair proteins MSH2MSH6 (MutSalpha) and MSH2MSH7 (MutSgamma).2003 · DOI: 10.1093/nar/gkg780 Regulation of plant MSH2 and MSH6 genes in the UV-B-induced DNA damage response.2011 · DOI: 10.1093/jxb/err001

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022526 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000727 double-strand break repair via break-induced replication Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0006271 DNA strand elongation involved in DNA replication Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0090329 regulation of DNA-templated DNA replication Biological Process

GO:0000347 THO complex Cellular Component

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0042555 MCM complex Cellular Component

KEGG gene cross-reference

ath:AT4G02060

dosa:Os12g0560700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.879

Rank 1 · TkA06G480070 · TK1151

Cytoplasm0.218

Rank 2 · TkA06G480070 · TK1151

Mitochondrion0.031

Rank 3 · TkA06G480070 · TK1151

Cell membrane0.021

Rank 4 · TkA06G480070 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA06G480070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05188MutS_II10-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G480070	`PF05188`	MutS_II	10	97	3.9e-09	37.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04716`	Arabidopsis thaliana	sp\|O04716\|MSH6_ARATH DNA mismatch repair protein MSH6	55.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card