RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_022526
Reference: OH-1004 Chr: Chr05 Coordinates: 135858-142248 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3462 bp · LXL04_022526|LXL04_022526|OH1004|cDNA

ATGAAGGACGTCGATTTTAGCCGGGACAAAGATCTGGCGAAGGATTTTCTTCAAAACTTCGCTGATGCAGAGGGCGAAGCGAAATATATTAGCATCCTTCAAGATGTCGCCAATAGGAAAGTCAAAGCAATCGAAATTGACATTGGAGACCTGTTTGATTACAAGGATTTGGACGAAGAGTTTGTGGGACGAGTTACTGAGAACACCCGGAGATATGTTGGAGTTTTTGCTGATGCGATTGATGAGTTGATCCCTAAGCC...

CDS

Download CDS FASTA

3462 bp · LXL04_022526|LXL04_022526|OH1004|CDS

ATGAAGGACGTCGATTTTAGCCGGGACAAAGATCTGGCGAAGGATTTTCTTCAAAACTTCGCTGATGCAGAGGGCGAAGCGAAATATATTAGCATCCTTCAAGATGTCGCCAATAGGAAAGTCAAAGCAATCGAAATTGACATTGGAGACCTGTTTGATTACAAGGATTTGGACGAAGAGTTTGTGGGACGAGTTACTGAGAACACCCGGAGATATGTTGGAGTTTTTGCTGATGCGATTGATGAGTTGATCCCTAAGCC...

Protein

Download Protein FASTA

1153 aa · LXL04_022526|LXL04_022526|OH1004|PROTEIN

MKDVDFSRDKDLAKDFLQNFADAEGEAKYISILQDVANRKVKAIEIDIGDLFDYKDLDEEFVGRVTENTRRYVGVFADAIDELIPKPTEAFQDDDLDILMTQRAEEGNDNADGTDPRQKMPPEIRRFYEVYIKASSKDQPFTIREVRDSHIGQLVKISGIVTRCTDVKPLMKVAVYTCEECGFEIYQEVTARVFMPLFECPSKRCNVNRAKGSLILQLRTSKFWKFQEIGSRYLLAEIYKFCLMQDAKLQELTEHVPKGH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_022526
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_022526
LocationChr05:135858-142248 (+)
DescriptionSimilar to MCM7: DNA replication licensing factor MCM7
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g02060 Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells (By similarity). No verified direct reference in this release
At4g02070 Component of the post-replicative DNA mismatch repair system (MMR).
Arabidopsis MutS homologs-AtMSH2, AtMSH3, AtMSH6, and a novel AtMSH7-form three distinct protein heterodimers with different specificities for mismatched DNA.2000 · DOI: 10.1105/tpc.12.6.991
Dissimilar mispair-recognition spectra of Arabidopsis DNA-mismatch-repair proteins MSH2*MSH6 (MutSalpha) and MSH2*MSH7 (MutSgamma).2003 · DOI: 10.1093/nar/gkg780
Regulation of plant MSH2 and MSH6 genes in the UV-B-induced DNA damage response.2011 · DOI: 10.1093/jxb/err001

Rice

Reference gene IDPossible functionPapers / DOI
Os12g0560700 Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells. No verified direct reference in this release
UniProt: B8BMI1 Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022526 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0000727 double-strand break repair via break-induced replication Biological Process
GO:0006270 DNA replication initiation Biological Process
GO:0006271 DNA strand elongation involved in DNA replication Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0009555 pollen development Biological Process
GO:0010182 sugar mediated signaling pathway Biological Process
GO:0090329 regulation of DNA-templated DNA replication Biological Process
GO:0000347 THO complex Cellular Component
GO:0000785 chromatin Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0042555 MCM complex Cellular Component
KEGG gene cross-reference
ath:AT4G02060
dosa:Os12g0560700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.892
Rank 1 · LXL04_022526 · OH-1004
Cytoplasm0.159
Rank 2 · LXL04_022526 · OH-1004
Mitochondrion0.035
Rank 3 · LXL04_022526 · OH-1004
Cell membrane0.025
Rank 4 · LXL04_022526 · OH-1004
Endoplasmic reticulum0.014
Rank 5 · LXL04_022526 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14551.12MCM_N13-97 aa
PF17207.10MCM_OB143-229 aa
PF17207.10MCM_OB238-292 aa
PF00493.30MCM332-430 aa
PF14551.12MCM_N434-508 aa
PF01624.26MutS_I822-849 aa
PF05188.24MutS_II927-1012 aa
PF05192.24MutS_III1115-1152 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_022526PF14551.12MCM_N13974e-2176.0
LXL04_022526PF17207.10MCM_OB1432297.1e-31107.3
LXL04_022526PF17207.10MCM_OB2382927.1e-31107.3
LXL04_022526PF00493.30MCM3324301.5e-1970.7
LXL04_022526PF14551.12MCM_N4345084e-2176.0
LXL04_022526PF01624.26MutS_I8228492.6e-0938.0
LXL04_022526PF05188.24MutS_II92710123.7e-0834.6
LXL04_022526PF05192.24MutS_III111511521.6e-0835.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P43299Arabidopsis thalianaDNA replication licensing factor MCM769.144%Swiss-Protweak database homology
O04716Arabidopsis thalianaDNA mismatch repair protein MSH647.246%Swiss-Protmoderate database homology
Q2QNM1Oryza sativa subsp. japonicaDNA replication licensing factor MCM771.910%Swiss-Protweak database homology
B8BMI1Oryza sativa subsp. indicaDNA replication licensing factor MCM771.910%Swiss-Protweak database homology

JBrowse

View in Genome Browser