Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1874 bp · TkA06G459300|TK1151|cDNA
GTTTGATTTGGGTATTCCATACTATAAAAGAAGGGGTTGTTCCATTTTAATTTGTTATTTTGTGCATCTGCTCAAGTCTGAAATGGCGGCCAGGCGGTGGTCGTAATGATGAATTGATGATGTTCGAAATGAGAATTGTCCAACACTCCAAACGATATTCGAAGCTTGTTGTGATTTTTTAGGACTTCATTGATTACTCCTACGTTATAAGCTGAGTAGCTGACTTTACTTCAGATTCAGACCAGCAATCCAACATCTGT...
1518 bp · TkA06G459300|TK1151|CDS
ATGGCGATTTCCATGGATTTTCTCTCTATTGCAGTTTCCACATCTATTCTTCTTCTTTGCCTCTATGTGTACAATCAACAGAAACAGGGCAAGAAGACGAAGAAGCATCATCCGATTCTCGGAACCATGTTCCATCAGCTCATTAACTTCAACAGATTGCATGATTACATGACTGATCTTGCTACAAAACACAAAACTTATAGATTGATTAGTCCTTTCCGCTACGAGGTTTATACATCTGATCCGGTTAATGTTGAGTA...
Protein
Download Protein FASTA505 aa · TkA06G459300|TK1151|PROTEIN
MAISMDFLSIAVSTSILLLCLYVYNQQKQGKKTKKHHPILGTMFHQLINFNRLHDYMTDLATKHKTYRLISPFRYEVYTSDPVNVEYILKTNFENYVKGAYNHDILRDLLGDGIFTVDGDRWREQRKVSSYEFSTKVLRDFSSVIFRKNAVKLAHILSQASSNNQILDINDFFMKATLDSIFKVAFGIDLDSMCGSSEEGVRFSNAFDDASALTLKRYVDPIWKTKKFFNIGSEAKLKENVKVVDEFVYKLIKTKTQQMH...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G459300 |
|---|---|
| TK1151 ID | TkA06G459300 |
| OH-1004 ID | LXL04_036541 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 54.700 |
| Protein coverage (%) | TK1151 96.832 / OH-1004 59.223Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G459300 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:113615709-113620976 (+) | |||||||||
| Description | Similar to CYP704C1: Cytochrome P450 704C1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006631 fatty acid metabolic process Biological Process GO:0008610 lipid biosynthetic process Biological Process GO:0010214 seed coat development Biological Process GO:0010345 suberin biosynthetic process Biological Process GO:0010584 pollen exine formation Biological Process GO:0035336 long-chain fatty-acyl-CoA metabolic process Biological Process GO:0042761 very long-chain fatty acid biosynthetic process Biological Process GO:0071555 cell wall organization Biological Process GO:0080110 sporopollenin biosynthetic process Biological Process GO:0005576 extracellular region Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005783 endoplasmic reticulum Cellular Component | |||||||||
| KEGG gene cross-reference | ag:AAZ39642 ath:AT1G69500 ath:AT2G45970 ath:AT5G23190 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00067p45035-486 aaPF20603Bact_hydrolase171-267 aaPF22947ULD_3204-263 aaPF20603Bact_hydrolase310-341 aaPF22947ULD_3439-458 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G459300 | PF00067 | p450 | 35 | 486 | 1.6e-71 | 242.2 |
| TkA06G459300 | PF20603 | Bact_hydrolase | 171 | 267 | 0.022 | 15.4 |
| TkA06G459300 | PF22947 | ULD_3 | 204 | 263 | 0.037 | 14.8 |
| TkA06G459300 | PF20603 | Bact_hydrolase | 310 | 341 | 0.022 | 15.4 |
| TkA06G459300 | PF22947 | ULD_3 | 439 | 458 | 0.037 | 14.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.