TkA06G428060 | RubberDandelionOmics

Gene overview

TkA06G428060

Reference: TK1151 Chr: Chr06 Coordinates: 105907667-105909010 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

937 bp · TkA06G428060|TK1151|cDNA

GAACAGAATCCGTTGCTGATATCACTTTCAAATAAAATACGAAAACCCACTAATGCTCGTGACTCTGCAATAAACCCTCTACCAAACTCTAGTTGTGGGTTCGTCAACCCCAAAAACCCTCGCAGAGGACCCGATAAAGGGGAGCTACAGTCTACATAGCGGTCACGAAACCCTCTAGTGGATAATAAAAATGTTTCTAAAAGTGAAACTAAACTGGAACGTAGTAATCCCAGCCGAAAGTCTCGACACAAAAGGCTTAA...

CDS

Download CDS FASTA

531 bp · TkA06G428060|TK1151|CDS

ATGTTTCTAAAAGTGAAACTAAACTGGAACGTAGTAATCCCAGCCGAAAGTCTCGACACAAAAGGCTTAATCCTCCAAAAAGCCATCCTGATCCGCCTCCTCGACGACTTCTCCGCCAAGAGAGCCACCAAGGACCTGGGCTACCTCCTGGCGGTAACCACCCTGGACAACATCGGAGAAGGCAAAGTCCGGGAACATTCCGGCGACGTCCTCTTTCCAGTCACGTTCACGTGCCTGAGCTTCAAGGTGTTCCGGGGGGA...

Protein

Download Protein FASTA

176 aa · TkA06G428060|TK1151|PROTEIN

MFLKVKLNWNVVIPAESLDTKGLILQKAILIRLLDDFSAKRATKDLGYLLAVTTLDNIGEGKVREHSGDVLFPVTFTCLSFKVFRGEVVEGVVHKVLKHGVFMRCGPIENLYLSNQKMKEYTYQIGESPCFLNMKTGSKIGKDGGVRCVVIGVKYMEAVKEFQAVVGLEGDHLGPV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G428060`
TK1151 ID	TkA06G428060
OH-1004 ID	LXL04_022919
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	32.400
Protein coverage (%)	TK1151 100.000 / OH-1004 83.333 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G428060

Location Chr06:105907667-105909010 (+)

Description Similar to NRPD7: DNA-directed RNA polymerase IV subunit 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14660`	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.	No verified direct reference in this release
`At3g22900`	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.	No verified direct reference in this release
`At5g59180`	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022919 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000956 nuclear-transcribed mRNA catabolic process Biological Process

GO:0006352 DNA-templated transcription initiation Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0045948 positive regulation of translational initiation Biological Process

GO:0060213 positive regulation of nuclear-transcribed mRNA poly(A) tail shortening Biological Process

GO:0000418 RNA polymerase IV complex Cellular Component

GO:0000419 RNA polymerase V complex Cellular Component

GO:0000428 DNA-directed RNA polymerase complex Cellular Component

GO:0000932 P-body Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005665 RNA polymerase II, core complex Cellular Component

GO:0003697 single-stranded DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G22900

ath:AT4G14520

ath:AT4G14660

ath:AT5G59180

gmx:100793057

gmx:547985

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.554

Rank 1 · TkA06G428060 · TK1151

Nucleus0.437

Rank 2 · TkA06G428060 · TK1151

Cell membrane0.100

Rank 3 · TkA06G428060 · TK1151

Endoplasmic reticulum0.062

Rank 4 · TkA06G428060 · TK1151

Mitochondrion0.046

Rank 5 · TkA06G428060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03876SHS2_Rpb7-N10-68 aa

PF00575S182-109 aa

PF03876SHS2_Rpb7-N141-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G428060	`PF03876`	SHS2_Rpb7-N	10	68	4.3e-07	30.6
TkA06G428060	`PF00575`	S1	82	109	0.027	15.6
TkA06G428060	`PF03876`	SHS2_Rpb7-N	141	157	4.3e-07	30.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A6QRA1`	Arabidopsis thaliana	sp\|A6QRA1\|NRPE7_ARATH DNA-directed RNA polymerase V subunit 7	64.200%	Swiss-Prot	High
`Q8LE42`	Arabidopsis thaliana	sp\|Q8LE42\|NRPD7_ARATH DNA-directed RNA polymerase IV subunit 7	53.700%	Swiss-Prot	High
`P38421`	Arabidopsis thaliana	sp\|P38421\|NRPB7_ARATH DNA-directed RNA polymerase II subunit 7	34.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card