TkA06G426780 | RubberDandelionOmics

Gene overview

TkA06G426780

Reference: TK1151 Chr: Chr06 Coordinates: 105565727-105567204 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

957 bp · TkA06G426780|TK1151|cDNA

ACATAACTTCACCTCCAATCCCCCAATGGATTCGGCTAGGCACACATGCTTGAAACTCCAAATCGCCCAAGATCGTCACCCATTTTTCATCAAAGGCACCTGGTTTCCTTCTCACTTCGATCTCTCAATCACCGACGGCCAAAACGCTTGGACTTGCAACGCGTCAGAAGAAGACGTGAAGGAGAGAGCGTCTAATTGGGACCAACCGACATCTGAGTACATCGATTTATCGGAGCGCTATTTAGGGTTTCAACAACCTG...

CDS

Download CDS FASTA

771 bp · TkA06G426780|TK1151|CDS

ATGGATTCGGCTAGGCACACATGCTTGAAACTCCAAATCGCCCAAGATCGTCACCCATTTTTCATCAAAGGCACCTGGTTTCCTTCTCACTTCGATCTCTCAATCACCGACGGCCAAAACGCTTGGACTTGCAACGCGTCAGAAGAAGACGTGAAGGAGAGAGCGTCTAATTGGGACCAACCGACATCTGAGTACATCGATTTATCGGAGCGCTATTTAGGGTTTCAACAACCTGGTTCGGTTTACGGGTTTACAGATGC...

Protein

Download Protein FASTA

256 aa · TkA06G426780|TK1151|PROTEIN

MDSARHTCLKLQIAQDRHPFFIKGTWFPSHFDLSITDGQNAWTCNASEEDVKERASNWDQPTSEYIDLSERYLGFQQPGSVYGFTDAGGGNKRLSWTFKKEGTKLEWRWKFNPAEDSKKITASILDFLMDSNIRLSEEVVMKTRSNEKLKTEAEKCLAQSEKFQNEKAEFETTIYSKFLGVLNSKKAKLRELRDKMSNQEIGVKPEEEEDEGESTDRTETYEGDSEDADVEEDTATNVTSTSKGALENKPRGRKRK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G426780`
TK1151 ID	TkA06G426780
OH-1004 ID	LXL04_022931
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 96.241 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G426780

Location Chr06:105565727-105567204 (+)

Description Similar to XRCC4: DNA repair protein XRCC4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23100`	May be involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022931 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006284 base-excision repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006310 DNA recombination Biological Process

GO:0010165 response to X-ray Biological Process

GO:0010212 response to ionizing radiation Biological Process

GO:0010332 response to gamma radiation Biological Process

GO:0048146 positive regulation of fibroblast proliferation Biological Process

GO:0051351 positive regulation of ligase activity Biological Process

GO:0061819 telomeric DNA-containing double minutes formation Biological Process

GO:1905765 negative regulation of protection from non-homologous end joining at telomere Biological Process

GO:1990166 protein localization to site of double-strand break Biological Process

KEGG gene cross-reference

ath:AT3G23100

hsa:7518

mmu:108138

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.894

Rank 1 · TkA06G426780 · TK1151

Cytoplasm0.212

Rank 2 · TkA06G426780 · TK1151

Mitochondrion0.030

Rank 3 · TkA06G426780 · TK1151

Cell membrane0.025

Rank 4 · TkA06G426780 · TK1151

Golgi apparatus0.013

Rank 5 · TkA06G426780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09302XLF11-111 aa

PF06632XRCC419-111 aa

PF05790C2-set31-57 aa

PF17234MPM134-57 aa

PF29997SPC25_N122-200 aa

PF17234MPM1140-243 aa

PF21924XRCC4_CC141-192 aa

PF06632XRCC4147-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G426780	`PF09302`	XLF	11	111	6.1e-06	27.2
TkA06G426780	`PF06632`	XRCC4	19	111	7.8e-29	100.4
TkA06G426780	`PF05790`	C2-set	31	57	0.16	12.9
TkA06G426780	`PF17234`	MPM1	34	57	1.0	10.3
TkA06G426780	`PF29997`	SPC25_N	122	200	0.055	14.5
TkA06G426780	`PF17234`	MPM1	140	243	1.0	10.3
TkA06G426780	`PF21924`	XRCC4_CC	141	192	5.2e-09	36.8
TkA06G426780	`PF06632`	XRCC4	147	163	7.8e-29	100.4
TkA06G426780	`PF05790`	C2-set	152	174	0.16	12.9
TkA06G426780	`PF09302`	XLF	174	174	6.1e-06	27.2
TkA06G426780	`PF12226`	Astro_capsid_p	189	235	0.058	13.3
TkA06G426780	`PF06632`	XRCC4	215	233	7.8e-29	100.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q682V0`	Arabidopsis thaliana	sp\|Q682V0\|XRCC4_ARATH DNA repair protein XRCC4	63.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card