TkA06G401800 | RubberDandelionOmics

Gene overview

TkA06G401800

Reference: TK1151 Chr: Chr06 Coordinates: 99502142-99502720 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

309 bp · TkA06G401800|TK1151|cDNA

ATGCAGGCGAGTGACAGGTTTAATATCAACTCCCAACTTGAGCATCTACAAGCCAAGTATGTAGGAACTGGACATGCAGACATGAACAGATTAACTAGTGAAATTGATATTTTGTTTTATTTGATATTTGGTTGGAGTGAATGGGCGGTTAATATCCAAAGAGACAGCTATGCATCATATGTTGGTCATTATCCAATGCTTGCTTATTTTGCAATTGCTGAAAATGAATCAATTGGGAGAGAACGCTACAACTTTATGCA...

CDS

Download CDS FASTA

309 bp · TkA06G401800|TK1151|CDS

ATGCAGGCGAGTGACAGGTTTAATATCAACTCCCAACTTGAGCATCTACAAGCCAAGTATGTAGGAACTGGACATGCAGACATGAACAGATTAACTAGTGAAATTGATATTTTGTTTTATTTGATATTTGGTTGGAGTGAATGGGCGGTTAATATCCAAAGAGACAGCTATGCATCATATGTTGGTCATTATCCAATGCTTGCTTATTTTGCAATTGCTGAAAATGAATCAATTGGGAGAGAACGCTACAACTTTATGCA...

Protein

Download Protein FASTA

102 aa · TkA06G401800|TK1151|PROTEIN

MQASDRFNINSQLEHLQAKYVGTGHADMNRLTSEIDILFYLIFGWSEWAVNIQRDSYASYVGHYPMLAYFAIAENESIGRERYNFMQKMLLPCGLPPEREDE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G401800`
TK1151 ID	TkA06G401800
OH-1004 ID	LXL04_023107
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.200
Protein coverage (%)	TK1151 99.020 / OH-1004 89.583 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G401800

Location Chr06:99502142-99502720 (-)

Description Similar to At3g23325: Uncharacterized protein At3g23325

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23325`	Uncharacterized protein At3g23325.	No verified direct reference in this release
`At4g14342`	Uncharacterized protein At4g14342.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023107 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000387 spliceosomal snRNP assembly Biological Process

GO:0000388 spliceosome conformational change to release U4 (or U4atac) and U1 (or U11) Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1903241 U2-type prespliceosome assembly Biological Process

GO:0000124 SAGA complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005684 U2-type spliceosomal complex Cellular Component

KEGG gene cross-reference

ath:AT3G23325

ath:AT4G14342

bta:574400

dme:Dmel_CG11985

hsa:83443

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.503

Rank 1 · TkA06G401800 · TK1151

Cytoplasm0.323

Rank 2 · TkA06G401800 · TK1151

Plastid0.102

Rank 3 · TkA06G401800 · TK1151

Mitochondrion0.069

Rank 4 · TkA06G401800 · TK1151

Extracellular0.053

Rank 5 · TkA06G401800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07189SF3b105-30 aa

PF10022BcGHD27-80 aa

PF07189SF3b1046-97 aa

PF28428TAM1261-89 aa

PF26202HA_Alsin61-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G401800	`PF07189`	SF3b10	5	30	1.5e-32	112.2
TkA06G401800	`PF10022`	BcGHD	27	80	0.058	13.1
TkA06G401800	`PF07189`	SF3b10	46	97	1.5e-32	112.2
TkA06G401800	`PF28428`	TAM12	61	89	0.0031	17.5
TkA06G401800	`PF26202`	HA_Alsin	61	90	0.26	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW64`	Arabidopsis thaliana	sp\|Q9LW64\|SF3BA_ARATH Uncharacterized protein At3g23325	79.400%	Swiss-Prot	High
`P58728`	Arabidopsis thaliana	sp\|P58728\|SF3BB_ARATH Uncharacterized protein At4g14342	79.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card