TkA06G353150 | RubberDandelionOmics

Gene overview

TkA06G353150

Reference: TK1151 Chr: Chr06 Coordinates: 87748551-87750132 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1172 bp · TkA06G353150|TK1151|cDNA

TATATCACTCAATCGATTGGATAGTTGAGATTTCATAGCGACGGTAACAATATTATGCACTCCGTTTTCGTATTTTGCTTTTGGTATATTACCCCTCTCCCCACTTTGCAGATGGCTTCTGAACCAGTGAAACGAGATTGGTCTATTGAAGATTTCGAGATCGGGAAACCCCTCGGAAAGGGAAAATTCGGTCGAGTATACCTCGGCCGTGAAGTCAAGAGCAAGTATATAGTGGCATTGAAAGTGATATTTAAAGAACA...

CDS

Download CDS FASTA

909 bp · TkA06G353150|TK1151|CDS

ATGCACTCCGTTTTCGTATTTTGCTTTTGGTATATTACCCCTCTCCCCACTTTGCAGATGGCTTCTGAACCAGTGAAACGAGATTGGTCTATTGAAGATTTCGAGATCGGGAAACCCCTCGGAAAGGGAAAATTCGGTCGAGTATACCTCGGCCGTGAAGTCAAGAGCAAGTATATAGTGGCATTGAAAGTGATATTTAAAGAACAAATCGAAAAATACAGACTGCAACACCAGCTCAAGAGAGAGATGGCGATACAAAC...

Protein

Download Protein FASTA

302 aa · TkA06G353150|TK1151|PROTEIN

MHSVFVFCFWYITPLPTLQMASEPVKRDWSIEDFEIGKPLGKGKFGRVYLGREVKSKYIVALKVIFKEQIEKYRLQHQLKREMAIQTSLGHPHVLKLYGWFHDAERIFLILEYAHGGELYGELRRSGHLSEKQAATYIASLTRALAYCHEKHVIHRDIKPENMLLDHEGRLKIANFGWSVRSKDKRHTMCGTLDYLAPEMVENKAHDYAIDNWTLGVLCYEFLYGVPPFEVDSQVDTFTRIMNIDLTFPPSPYVSMEAKH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G353150`
TK1151 ID	TkA06G353150
OH-1004 ID	LXL04_031393
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	72.600
Protein coverage (%)	TK1151 94.371 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G353150

Location Chr06:87748551-87750132 (+)

Description Similar to AUR3: Serine/threonine-protein kinase Aurora-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45490`	Phosphorylates in vitro histone H3 at 'Ser-10' (H3S10ph) and 'Ser-28' (H3S28ph), but not at 'Thr-3' (H3T3ph) or 'Thr-11' (H3T11ph).	Characterization of plant Aurora kinases during mitosis.2005 · DOI: 10.1007/s11103-005-3454-x Aurora kinase is required for chromosome segregation in tobacco BY-2 cells.2006 · DOI: 10.1111/j.1365-313x.2006.02893.x
`At2g25880`	Phosphorylates specifically 'Ser-10' of histone H3 in vitro.	Characterization of plant Aurora kinases during mitosis.2005 · DOI: 10.1007/s11103-005-3454-x
`At4g32830`	Phosphorylates specifically 'Ser-10' of histone H3 in vitro and colocalizes with phosphorylated histone H3 during mitosis.	Characterization of plant Aurora kinases during mitosis.2005 · DOI: 10.1007/s11103-005-3454-x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031393 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000212 meiotic spindle organization Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0007100 mitotic centrosome separation Biological Process

GO:0016310 phosphorylation Biological Process

GO:0018105 peptidyl-serine phosphorylation Biological Process

GO:0032465 regulation of cytokinesis Biological Process

GO:0043687 post-translational protein modification Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0051301 cell division Biological Process

GO:0090307 mitotic spindle assembly Biological Process

GO:0000775 chromosome, centromeric region Cellular Component

GO:0000776 kinetochore Cellular Component

KEGG gene cross-reference

ath:AT2G25880

ath:AT2G45490

ath:AT4G32830

xla:397925

xla:398349

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.656

Rank 1 · TkA06G353150 · TK1151

Nucleus0.420

Rank 2 · TkA06G353150 · TK1151

Cell membrane0.078

Rank 3 · TkA06G353150 · TK1151

Mitochondrion0.069

Rank 4 · TkA06G353150 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA06G353150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase34-295 aa

PF07714PK_Tyr_Ser-Thr35-242 aa

PF03109ABC138-67 aa

PF01636APH49-149 aa

PF03109ABC1106-190 aa

PF14531Kinase-like128-220 aa

PF07387Seadorna_VP7143-175 aa

PF17667Pkinase_fungal149-211 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G353150	`PF00069`	Pkinase	34	295	3.5e-66	224.0
TkA06G353150	`PF07714`	PK_Tyr_Ser-Thr	35	242	5.7e-37	128.1
TkA06G353150	`PF03109`	ABC1	38	67	0.0018	18.2
TkA06G353150	`PF01636`	APH	49	149	0.0055	17.2
TkA06G353150	`PF03109`	ABC1	106	190	0.0018	18.2
TkA06G353150	`PF14531`	Kinase-like	128	220	6.4e-06	26.3
TkA06G353150	`PF07387`	Seadorna_VP7	143	175	0.27	11.0
TkA06G353150	`PF17667`	Pkinase_fungal	149	211	0.025	14.0
TkA06G353150	`PF01636`	APH	151	171	0.0055	17.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64629`	Arabidopsis thaliana	sp\|O64629\|AUR3_ARATH Serine/threonine-protein kinase Aurora-3	73.800%	Swiss-Prot	High
`Q683C9`	Arabidopsis thaliana	sp\|Q683C9\|AUR2_ARATH Serine/threonine-protein kinase Aurora-2	58.200%	Swiss-Prot	High
`Q9M077`	Arabidopsis thaliana	sp\|Q9M077\|AUR1_ARATH Serine/threonine-protein kinase Aurora-1	57.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card