LXL04_031393 | RubberDandelionOmics

Gene overview

LXL04_031393

Reference: OH-1004 Chr: Chr07 Coordinates: 5313592-5314900 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

733 bp · LXL04_031393|LXL04_031393|OH1004|cDNA

ATGCACTCCGTTTTCGTCTTTTGCTTTTGGTAAAATTACCCCTCTCCCCACTTTGCAGATGGCTTCCGAACCAGTGAAACGAGATTGGTCTATTGAAGATTTCGAGATCGGGAAACTCCTCGGCAAGGGAAAATTCGGTCGAGTATACCTCGCCCGTGAAGTCAAGAGCAAGTATATAGTGTCATTGAAATATGCTCATGGAGGTGAGCTCTATGGAGAGCTTCGTAGATCTGGTTGTTTCTCCGAGAAACAAGCTGCCA...

CDS

Download CDS FASTA

681 bp · LXL04_031393|LXL04_031393|OH1004|CDS

TTGCAGATGGCTTCCGAACCAGTGAAACGAGATTGGTCTATTGAAGATTTCGAGATCGGGAAACTCCTCGGCAAGGGAAAATTCGGTCGAGTATACCTCGCCCGTGAAGTCAAGAGCAAGTATATAGTGTCATTGAAATATGCTCATGGAGGTGAGCTCTATGGAGAGCTTCGTAGATCTGGTTGTTTCTCCGAGAAACAAGCTGCCACTTACATTGCTAGCCTTACACAAGCATTAGCTTATTGTCATGAGAAGCATGT...

Protein

Download Protein FASTA

226 aa · LXL04_031393|LXL04_031393|OH1004|PROTEIN

MQMASEPVKRDWSIEDFEIGKLLGKGKFGRVYLAREVKSKYIVSLKYAHGGELYGELRRSGCFSEKQAATYIASLTQALAYCHEKHVIHRDIKPENLLLDHEGRLKIADFGWSVRSEDKRHTMCGTLDYLAPEMVENKAHDYAVDNWTLGVLCYEFLYGVPPFEADGQADTFTRIMKIDLTFPPSSYVSMEAKHLITRLLVKDSEKRLPLEKILKHHWIIVNVDCP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031393`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031393

Location Chr07:5313592-5314900 (-)

Description Similar to AUR3: Serine/threonine-protein kinase Aurora-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45490`	Phosphorylates in vitro histone H3 at 'Ser-10' (H3S10ph) and 'Ser-28' (H3S28ph), but not at 'Thr-3' (H3T3ph) or 'Thr-11' (H3T11ph).	Characterization of plant Aurora kinases during mitosis.2005 · DOI: 10.1007/s11103-005-3454-x Aurora kinase is required for chromosome segregation in tobacco BY-2 cells.2006 · DOI: 10.1111/j.1365-313x.2006.02893.x
`At2g25880`	Phosphorylates specifically 'Ser-10' of histone H3 in vitro.	Characterization of plant Aurora kinases during mitosis.2005 · DOI: 10.1007/s11103-005-3454-x
`At4g32830`	Phosphorylates specifically 'Ser-10' of histone H3 in vitro and colocalizes with phosphorylated histone H3 during mitosis.	Characterization of plant Aurora kinases during mitosis.2005 · DOI: 10.1007/s11103-005-3454-x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031393 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000212 meiotic spindle organization Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0007100 mitotic centrosome separation Biological Process

GO:0016310 phosphorylation Biological Process

GO:0018105 peptidyl-serine phosphorylation Biological Process

GO:0032465 regulation of cytokinesis Biological Process

GO:0043687 post-translational protein modification Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0051301 cell division Biological Process

GO:0090307 mitotic spindle assembly Biological Process

GO:0000775 chromosome, centromeric region Cellular Component

GO:0000776 kinetochore Cellular Component

KEGG gene cross-reference

ath:AT2G25880

ath:AT2G45490

ath:AT4G32830

xla:397925

xla:398349

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.652

Rank 1 · LXL04_031393 · OH-1004

Nucleus0.468

Rank 2 · LXL04_031393 · OH-1004

Cell membrane0.076

Rank 3 · LXL04_031393 · OH-1004

Mitochondrion0.053

Rank 4 · LXL04_031393 · OH-1004

Endoplasmic reticulum0.045

Rank 5 · LXL04_031393 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase38-219 aa

PF07714.24PK_Tyr_Ser-Thr40-215 aa

PF14531.13Kinase-like75-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031393	`PF00069.32`	Pkinase	38	219	1.5e-54	185.9
LXL04_031393	`PF07714.24`	PK_Tyr_Ser-Thr	40	215	1.5e-25	90.7
LXL04_031393	`PF14531.13`	Kinase-like	75	207	2.7e-06	27.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64629`	Arabidopsis thaliana	Serine/threonine-protein kinase Aurora-3	61.654%	Swiss-Prot	strong database homology
`Q683C9`	Arabidopsis thaliana	Serine/threonine-protein kinase Aurora-2	51.103%	Swiss-Prot	strong database homology
`Q9M077`	Arabidopsis thaliana	Serine/threonine-protein kinase Aurora-1	50.566%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card