TkA06G237160 | RubberDandelionOmics

Gene overview

TkA06G237160

Reference: TK1151 Chr: Chr06 Coordinates: 60821543-60822365 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

570 bp · TkA06G237160|TK1151|cDNA

ATGCTGAAGGATGTAGTGAGAACCAAGACCTACCAAAATGTCATTTACAAGAACAAGTTTTTATTCAAGGACAAAATTGTCCTTGATGTTGGTGCTGAGACAGGAATATTATCCCTATTCTGTGCAAAAGCTGGTGCAAAGCATGTTTATGCTATTGAGTGCTCACAAATGGCTGACATGGCACAAGAGATTGTTAAAGCAAATGTCTTTTCAGATGGTATAACTGTATTGAAGGGAAAAGTTGAAATTGACCTTCAAAT...

CDS

Download CDS FASTA

570 bp · TkA06G237160|TK1151|CDS

ATGCTGAAGGATGTAGTGAGAACCAAGACCTACCAAAATGTCATTTACAAGAACAAGTTTTTATTCAAGGACAAAATTGTCCTTGATGTTGGTGCTGAGACAGGAATATTATCCCTATTCTGTGCAAAAGCTGGTGCAAAGCATGTTTATGCTATTGAGTGCTCACAAATGGCTGACATGGCACAAGAGATTGTTAAAGCAAATGTCTTTTCAGATGGTATAACTGTATTGAAGGGAAAAGTTGAAATTGACCTTCAAAT...

Protein

Download Protein FASTA

189 aa · TkA06G237160|TK1151|PROTEIN

MLKDVVRTKTYQNVIYKNKFLFKDKIVLDVGAETGILSLFCAKAGAKHVYAIECSQMADMAQEIVKANVFSDGITVLKGKVEIDLQIPQVDIIILEWTGYFLLYENMLNTVLYARDKWLVSDRSTMELSYSIHLTAIEDANILFYPFKKNLCFCYFTVWNNVYGFDMSCIRKQSMMEPLVDKMTGFSTG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G237160`
TK1151 ID	TkA06G237160
OH-1004 ID	LXL04_001829
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.000
Protein coverage (%)	TK1151 100.000 / OH-1004 43.573 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G237160

Location Chr06:60821543-60822365 (+)

Description Similar to PRMT1: Probable protein arginine N-methyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29510`	Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in a glycine and arginine-rich domain.	Identification and characterization of two closely related histone H4 arginine 3 methyltransferases in Arabidopsis thaliana.2007 · DOI: 10.1042/bj20070786 PRMT11: a new Arabidopsis MBD7 protein partner with arginine methyltransferase activity.2007 · DOI: 10.1111/j.1365-313x.2007.03238.x
`At2g19670`	Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in a glycine and arginine-rich domain.	Identification and characterization of two closely related histone H4 arginine 3 methyltransferases in Arabidopsis thaliana.2007 · DOI: 10.1042/bj20070786

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Z0C0`	Arginine methyltransferase that methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in target proteins.	No verified direct reference in this release
`Os09g0359800`	Arginine methyltransferase that methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in target proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001829 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0032259 methylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0031514 motile cilium Cellular Component

GO:0016274 protein-arginine N-methyltransferase activity Molecular Function

GO:0035241 protein-arginine omega-N monomethyltransferase activity Molecular Function

GO:0035242 protein-arginine omega-N asymmetric methyltransferase activity Molecular Function

GO:0042054 histone methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G19670

ath:AT4G29510

cre:CHLRE_03g172550v5

dosa:Os09g0359800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.572

Rank 1 · TkA06G237160 · TK1151

Nucleus0.363

Rank 2 · TkA06G237160 · TK1151

Mitochondrion0.101

Rank 3 · TkA06G237160 · TK1151

Endoplasmic reticulum0.063

Rank 4 · TkA06G237160 · TK1151

Cell membrane0.058

Rank 5 · TkA06G237160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01728FtsJ17-63 aa

PF13489Methyltransf_2321-79 aa

PF06325PrmA22-94 aa

PF12847Methyltransf_1822-94 aa

PF05175MTS23-94 aa

PF13649Methyltransf_2527-95 aa

PF08241Methyltransf_1128-99 aa

PF22528PRMT_C48-77 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G237160	`PF01728`	FtsJ	17	63	0.00047	20.8
TkA06G237160	`PF13489`	Methyltransf_23	21	79	0.0014	19.1
TkA06G237160	`PF06325`	PrmA	22	94	8.2e-07	29.5
TkA06G237160	`PF12847`	Methyltransf_18	22	94	0.09	13.5
TkA06G237160	`PF05175`	MTS	23	94	0.0046	17.3
TkA06G237160	`PF13649`	Methyltransf_25	27	95	0.00055	21.3
TkA06G237160	`PF08241`	Methyltransf_11	28	99	0.0059	17.9
TkA06G237160	`PF22528`	PRMT_C	48	77	4.6e-06	27.4
TkA06G237160	`PF22528`	PRMT_C	155	185	4.6e-06	27.4
TkA06G237160	`PF13489`	Methyltransf_23	159	173	0.0014	19.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU94`	Arabidopsis thaliana	sp\|Q9SU94\|ANM11_ARATH Protein arginine N-methyltransferase 1.1	70.900%	Swiss-Prot	High
`O82210`	Arabidopsis thaliana	sp\|O82210\|ANM12_ARATH Probable protein arginine N-methyltransferase 1.2	66.100%	Swiss-Prot	High
`A2Z0C0`	Oryza sativa subsp. indica	sp\|A2Z0C0\|ANM1_ORYSI Protein arginine N-methyltransferase 1	70.900%	Swiss-Prot	High
`Q0J2C6`	Oryza sativa subsp. japonica	sp\|Q0J2C6\|ANM1_ORYSJ Protein arginine N-methyltransferase 1	70.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card