TkA06G211650 | RubberDandelionOmics

Gene overview

TkA06G211650

Reference: TK1151 Chr: Chr06 Coordinates: 54841679-54844101 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1267 bp · TkA06G211650|TK1151|cDNA

GTAGGTTTCAAATTGCGTCATTTTTGCGATTAAACTCACAACTTTAAAGATGAGTTGAACGTTAGTTGCAATTATGTCAACGCTGTACACCTTATAACCACTCCAGGCTGAACATTTCTTTCGTAAAAGTTGATTACCTGAGTCCTGAGAGATGGAAGTGGTACCGCTATACTGTTTGATTACAGTACTGGTTCTTGCCGGAACCGGAAAAGGTCAATTGGTTGAGAATTTCTATGCCGGACCCTGTCCCATGGTGGAAA...

CDS

Download CDS FASTA

969 bp · TkA06G211650|TK1151|CDS

ATGGAAGTGGTACCGCTATACTGTTTGATTACAGTACTGGTTCTTGCCGGAACCGGAAAAGGTCAATTGGTTGAGAATTTCTATGCCGGACCCTGTCCCATGGTGGAAACCATCGTGAGACAGACGGTGGTCACCAAGGTCGGCCAGACGTTCACAACAATTCCGGCCACTCTTCGTCTCTTTTTCCATGACTGTTTCGTTGAGGGTTGTGATGCTTCTGTTATGATCGCATCGCCAAATGGAGACGCGGAGAAGGACGC...

Protein

Download Protein FASTA

322 aa · TkA06G211650|TK1151|PROTEIN

MEVVPLYCLITVLVLAGTGKGQLVENFYAGPCPMVETIVRQTVVTKVGQTFTTIPATLRLFFHDCFVEGCDASVMIASPNGDAEKDAEDNLSLAGDGFDTVVKAKDAVEAVCPGVVSCADVLAIAARDVVAQAGGPFFSVELGRRDGLISQASRVTGKLPEPTFNLNQLNTMFARNNLTELDMIALSGAHTLGFSHCDRFANRLYSFSPASAVDPSLNPSYAQQLMAACPQNVAPDIAIDMDPETPRAFDNVYYQNLVAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G211650`
TK1151 ID	TkA06G211650
OH-1004 ID	LXL04_023824
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G211650

Location Chr06:54841679-54844101 (+)

Description Similar to PER51: Peroxidase 51

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37530`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At5g14130`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At4g37520`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At5g67400`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At4g30170`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023824 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0048511 rhythmic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0035618 root hair Cellular Component

GO:0020037 heme binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0140825 lactoperoxidase activity Molecular Function

KEGG gene cross-reference

ath:AT3G49960

ath:AT4G37520

ath:AT4G37530

ath:AT5G14130

ath:AT5G67400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.325

Rank 1 · TkA06G211650 · TK1151

Lysosome / Vacuole0.237

Rank 2 · TkA06G211650 · TK1151

Cytoplasm0.178

Rank 3 · TkA06G211650 · TK1151

Cell membrane0.079

Rank 4 · TkA06G211650 · TK1151

Endoplasmic reticulum0.076

Rank 5 · TkA06G211650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00141peroxidase39-286 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G211650	`PF00141`	peroxidase	39	286	2.8e-82	276.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZE7`	Arabidopsis thaliana	sp\|Q9SZE7\|PER51_ARATH Peroxidase 51	64.400%	Swiss-Prot	High
`Q96509`	Arabidopsis thaliana	sp\|Q96509\|PER55_ARATH Peroxidase 55	66.600%	Swiss-Prot	High
`Q43731`	Arabidopsis thaliana	sp\|Q43731\|PER50_ARATH Peroxidase 50	61.600%	Swiss-Prot	High
`Q43873`	Arabidopsis thaliana	sp\|Q43873\|PER73_ARATH Peroxidase 73	62.000%	Swiss-Prot	High
`Q96522`	Arabidopsis thaliana	sp\|Q96522\|PER45_ARATH Peroxidase 45	59.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card