LXL04_023824 | RubberDandelionOmics

Gene overview

LXL04_023824

Reference: OH-1004 Chr: Chr05 Coordinates: 70104588-70107003 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

969 bp · LXL04_023824|LXL04_023824|OH1004|cDNA

ATGGAAGTGGTACCGCTATACTGTTTGATTACAGTACTGGTTCTTGCTGGAACCGGAAAAGGTCAATTGGCTGAGAATTTCTATGCCGGAACCTGTCCGATGGTGGAAACGATCGTGAGACAAACGGTGGTCACCAAGGTCGGCCAGACGTTCACAACAATTCCGGCTACCCTTCGTCTCTTTTTCCACGACTGTTTCGTTGAGGGTTGTGATGCTTCTGTTATGATCGCGTCGCCAAATGGAGACGCGGAGAAGGATGC...

CDS

Download CDS FASTA

969 bp · LXL04_023824|LXL04_023824|OH1004|CDS

ATGGAAGTGGTACCGCTATACTGTTTGATTACAGTACTGGTTCTTGCTGGAACCGGAAAAGGTCAATTGGCTGAGAATTTCTATGCCGGAACCTGTCCGATGGTGGAAACGATCGTGAGACAAACGGTGGTCACCAAGGTCGGCCAGACGTTCACAACAATTCCGGCTACCCTTCGTCTCTTTTTCCACGACTGTTTCGTTGAGGGTTGTGATGCTTCTGTTATGATCGCGTCGCCAAATGGAGACGCGGAGAAGGATGC...

Protein

Download Protein FASTA

322 aa · LXL04_023824|LXL04_023824|OH1004|PROTEIN

MEVVPLYCLITVLVLAGTGKGQLAENFYAGTCPMVETIVRQTVVTKVGQTFTTIPATLRLFFHDCFVEGCDASVMIASPNGDAEKDAEDNLSLAGDGFDTVIKAKQAVESVCPGVVSCADVLAIAARDVVAQAGGPLFSVELGRRDGLISQASRVTGKLPEPTFNLNQLNTMFARNNLTELDMIALSGAHTLGFSHCDRFANRLYSFSPASTVDPSLNPSYAQQLMAACPQNVAPDIAIDMDPETPRAFDNVYYQNLVAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023824`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023824

Location Chr05:70104588-70107003 (-)

Description Similar to PER51: Peroxidase 51

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37530`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At5g14130`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At4g37520`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At5g67400`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At3g49960`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023824 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0048511 rhythmic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0035618 root hair Cellular Component

GO:0020037 heme binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0140825 lactoperoxidase activity Molecular Function

KEGG gene cross-reference

ath:AT3G49960

ath:AT4G37520

ath:AT4G37530

ath:AT5G14130

ath:AT5G67400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.319

Rank 1 · LXL04_023824 · OH-1004

Lysosome / Vacuole0.246

Rank 2 · LXL04_023824 · OH-1004

Cytoplasm0.180

Rank 3 · LXL04_023824 · OH-1004

Cell membrane0.085

Rank 4 · LXL04_023824 · OH-1004

Endoplasmic reticulum0.076

Rank 5 · LXL04_023824 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00141.29peroxidase39-286 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023824	`PF00141.29`	peroxidase	39	286	6.3e-82	275.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZE7`	Arabidopsis thaliana	Peroxidase 51	67.763%	Swiss-Prot	strong database homology
`Q96509`	Arabidopsis thaliana	Peroxidase 55	67.532%	Swiss-Prot	strong database homology
`Q43731`	Arabidopsis thaliana	Peroxidase 50	64.145%	Swiss-Prot	strong database homology
`Q43873`	Arabidopsis thaliana	Peroxidase 73	59.443%	Swiss-Prot	strong database homology
`Q96510`	Arabidopsis thaliana	Peroxidase 35	59.434%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card