TkA06G205370 | RubberDandelionOmics

Gene overview

TkA06G205370

Reference: TK1151 Chr: Chr06 Coordinates: 53216298-53217743 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

522 bp · TkA06G205370|TK1151|cDNA

ATGGCCACAACCATCTTCAACCTCCCCTTCTATATTTACCCTTCATCTCTCTCTCATTTTGGCGTAAACCATTCCGCTAGCACCATCACCGGGAACCACCGCCACAACAATCATACCTCCATCGTTGTTGCTGCTCAAATCAGCTTGATGCATCATCTTAACGACCTAACCATCAGCCTCCCCCTCCACCGCCACCATCATCGCATCATCTTGACGGCACCACCATCGCATCGCTCGGATACCCCATCGCAGAATCAAAG...

CDS

Download CDS FASTA

522 bp · TkA06G205370|TK1151|CDS

ATGGCCACAACCATCTTCAACCTCCCCTTCTATATTTACCCTTCATCTCTCTCTCATTTTGGCGTAAACCATTCCGCTAGCACCATCACCGGGAACCACCGCCACAACAATCATACCTCCATCGTTGTTGCTGCTCAAATCAGCTTGATGCATCATCTTAACGACCTAACCATCAGCCTCCCCCTCCACCGCCACCATCATCGCATCATCTTGACGGCACCACCATCGCATCGCTCGGATACCCCATCGCAGAATCAAAG...

Protein

Download Protein FASTA

173 aa · TkA06G205370|TK1151|PROTEIN

MATTIFNLPFYIYPSSLSHFGVNHSASTITGNHRHNNHTSIVVAAQISLMHHLNDLTISLPLHRHHHRIILTAPPSHRSDTPSQNQRSLLIVAEDIESEALATLILNKLRAGIKVCAIKAPGFGENRKSNLQDLATLTGGEVTISKDDTVILDGAGDKKGIEERCDQVFMFYS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G205370`
TK1151 ID	TkA06G205370
OH-1004 ID	LXL04_023666
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	67.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G205370

Location Chr06:53216298-53217743 (+)

Description Similar to CPN60: Chaperonin CPN60, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23990`	Implicated in mitochondrial protein import and macromolecular assembly.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023666 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000373 Group II intron splicing Biological Process

GO:0006457 protein folding Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0009408 response to heat Biological Process

GO:0042026 protein refolding Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G23990

zma:542707

zma:542736

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.900

Rank 1 · TkA06G205370 · TK1151

Nucleus0.092

Rank 2 · TkA06G205370 · TK1151

Mitochondrion0.056

Rank 3 · TkA06G205370 · TK1151

Cytoplasm0.043

Rank 4 · TkA06G205370 · TK1151

Cell membrane0.024

Rank 5 · TkA06G205370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00118Cpn60_TCP184-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G205370	`PF00118`	Cpn60_TCP1	84	163	0.017	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P29197`	Arabidopsis thaliana	sp\|P29197\|CH60A_ARATH Chaperonin CPN60, mitochondrial	68.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card