Gene Card
Gene overview
cDNA / CDS / Protein Sequences
720 bp · LXL04_023666|LXL04_023666|OH1004|cDNA
ATGGCCACAACCATCTTCAACCTCCCCTTCTATACTTACCCTTCATCTCTCCCTCATTTTGGCGTAAACCATTCCGCTAGCACCATCACCGGGAACCACCGCCACAACAATCGTACCTCCATCGTTGTTGCTGCTCAAATCAGCTTGATGCATCATCTTGACGACCCAACCATCAGCCTCCCCCTCCACCGCCACCATCATCGCATCACCTTGACGGCACCACCATCGCATCGCTCGGGTACCCCATCGCAGGTCTGCTC...
720 bp · LXL04_023666|LXL04_023666|OH1004|CDS
ATGGCCACAACCATCTTCAACCTCCCCTTCTATACTTACCCTTCATCTCTCCCTCATTTTGGCGTAAACCATTCCGCTAGCACCATCACCGGGAACCACCGCCACAACAATCGTACCTCCATCGTTGTTGCTGCTCAAATCAGCTTGATGCATCATCTTGACGACCCAACCATCAGCCTCCCCCTCCACCGCCACCATCATCGCATCACCTTGACGGCACCACCATCGCATCGCTCGGGTACCCCATCGCAGGTCTGCTC...
Protein
Download Protein FASTA239 aa · LXL04_023666|LXL04_023666|OH1004|PROTEIN
MATTIFNLPFYTYPSSLPHFGVNHSASTITGNHRHNNRTSIVVAAQISLMHHLDDPTISLPLHRHHHRITLTAPPSHRSGTPSQVCSSMAEHLPSIFGSEKDRVNCPFYFKIGAWIEAIYHLTSSLLIVAEDIESEALATLILNKLRAGIKVCAIKAPGFGEKRKSNLQDLATLTGGEVGPICPVITDELGMNLDKMAAEMLGTCKRVTISKDDTVILDGAGDKKGIEERCEQVFMFYS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_023666 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_023666 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr05:61995949-61997393 (+) | ||||||
| Description | Similar to CPN60: Chaperonin CPN60, mitochondrial | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0000373 Group II intron splicing Biological Process GO:0006457 protein folding Biological Process GO:0007005 mitochondrion organization Biological Process GO:0009408 response to heat Biological Process GO:0042026 protein refolding Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0022626 cytosolic ribosome Cellular Component GO:0003723 RNA binding Molecular Function | ||||||
| KEGG gene cross-reference | ath:AT3G23990 zma:542707 zma:542736 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
P29197 | Arabidopsis thaliana | Chaperonin CPN60, mitochondrial | 81.651% | Swiss-Prot | weak database homology |