TkA06G173400 | RubberDandelionOmics

Gene overview

TkA06G173400

Reference: TK1151 Chr: Chr06 Coordinates: 45524594-45525359 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

666 bp · TkA06G173400|TK1151|cDNA

ATGGCGAATACCGGCGGCGATTTGGCACCACCGCAACGGAGAGCTCCACCAATGCTAACACTCGCACCACGGTCTTCTTCCGATACATTCCTCACTGAAATTAGCCCTGGCCCCATGACACTTGTCTCCAATTTCTTCTCCGATCACTACCCTGACGCTGATCTCCGTTCCCTCTCTCAGCTTCTCGCCGGAGTCATACCTTCCCCCACCGCTGAATACCCGCCTCCACATTGCAGTGACGCACCTCTTTTATCCGCGGA...

CDS

Download CDS FASTA

666 bp · TkA06G173400|TK1151|CDS

ATGGCGAATACCGGCGGCGATTTGGCACCACCGCAACGGAGAGCTCCACCAATGCTAACACTCGCACCACGGTCTTCTTCCGATACATTCCTCACTGAAATTAGCCCTGGCCCCATGACACTTGTCTCCAATTTCTTCTCCGATCACTACCCTGACGCTGATCTCCGTTCCCTCTCTCAGCTTCTCGCCGGAGTCATACCTTCCCCCACCGCTGAATACCCGCCTCCACATTGCAGTGACGCACCTCTTTTATCCGCGGA...

Protein

Download Protein FASTA

221 aa · TkA06G173400|TK1151|PROTEIN

MANTGGDLAPPQRRAPPMLTLAPRSSSDTFLTEISPGPMTLVSNFFSDHYPDADLRSLSQLLAGVIPSPTAEYPPPHCSDAPLLSAEESLTPQTSDPDESQKNAALSQSDDSMPEPVVGLSQPDGDGYNWRKYGQKQVKASELPRSYYRCKQINCKVTKKIGHFLDGSTSEIIYSGRHNHEPPELQKPVDADEKSEGRCVDRSDTCRWWSLIQRLWCRRKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G173400`
TK1151 ID	TkA06G173400
OH-1004 ID	LXL04_024137
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.400
Protein coverage (%)	TK1151 93.665 / OH-1004 69.970 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G173400

Location Chr06:45524594-45525359 (+)

Description Similar to WRKY58: Probable WRKY transcription factor 58

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13960`	Transcription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis- acting element.	Roles of Arabidopsis WRKY3 and WRKY4 transcription factors in plant responses to pathogens.2008 · DOI: 10.1186/1471-2229-8-68 Structural basis for sequence-specific DNA recognition by an Arabidopsis WRKY transcription factor.2012 · DOI: 10.1074/jbc.m111.279844
`At2g03340`	Transcription factor.	No verified direct reference in this release
`At2g37260`	Transcription factor.	TRANSPARENT TESTA GLABRA2, a trichome and seed coat development gene of Arabidopsis, encodes a WRKY transcription factor.2002 · DOI: 10.1105/tpc.001404

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q6B6R4`	Transcription repressor (By similarity).	No verified direct reference in this release
`Os01g0826400`	May participate in transcriptional regulation of abscisic acid and gibberellin signaling.	Annotations and functional analyses of the rice WRKY gene superfamily reveal positive and negative regulators of abscisic acid signaling in aleurone cells.2005 · DOI: 10.1104/pp.104.054312 A negative regulator encoded by a rice WRKY gene represses both abscisic acid and gibberellins signaling in aleurone cells.2009 · DOI: 10.1007/s11103-009-9463-4

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024137 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT2G03340

ath:AT3G01080

ath:AT5G07100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.885

Rank 1 · TkA06G173400 · TK1151

Cytoplasm0.219

Rank 2 · TkA06G173400 · TK1151

Mitochondrion0.037

Rank 3 · TkA06G173400 · TK1151

Cell membrane0.029

Rank 4 · TkA06G173400 · TK1151

Endoplasmic reticulum0.017

Rank 5 · TkA06G173400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03106WRKY126-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G173400	`PF03106`	WRKY	126	181	1.1e-21	77.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XI90`	Arabidopsis thaliana	sp\|Q9XI90\|WRKY4_ARATH Probable WRKY transcription factor 4	38.200%	Swiss-Prot	Medium
`Q9ZQ70`	Arabidopsis thaliana	sp\|Q9ZQ70\|WRKY3_ARATH Probable WRKY transcription factor 3	62.900%	Swiss-Prot	Low
`Q9ZUU0`	Arabidopsis thaliana	sp\|Q9ZUU0\|WRK44_ARATH WRKY transcription factor 44	58.700%	Swiss-Prot	Low
`Q6B6R4`	Oryza sativa subsp. indica	sp\|Q6B6R4\|WRK24_ORYSI WRKY transcription factor WRKY24	56.900%	Swiss-Prot	Low
`Q6IEQ7`	Oryza sativa subsp. japonica	sp\|Q6IEQ7\|WRK24_ORYSJ WRKY transcription factor WRKY24	56.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card