LXL04_024137 | RubberDandelionOmics

Gene overview

LXL04_024137

Reference: OH-1004 Chr: Chr05 Coordinates: 82127828-82130581 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1002 bp · LXL04_024137|LXL04_024137|OH1004|cDNA

ATGGCGAATACCGGCGGCGATTTGGCACCACCGCAACGGAGAGCTCCACCAATGCTAACACTCGCACCACGGTCTTCTTCCGATACATTCCTCACTGAAATTAGCCCTGGCCCCATGACACTTGTCTCCAATTTCTTCTCCGATCACTACCCTGACGCTGATCTCCGTTCCCTCTCTCAGCTTCTCGCCGGAGTCATACCTTCCCCCACCGCTGAATACCCGCCTCCACATTGCAGTGACGCACCTCTTTTATCCGCGGA...

CDS

Download CDS FASTA

1002 bp · LXL04_024137|LXL04_024137|OH1004|CDS

ATGGCGAATACCGGCGGCGATTTGGCACCACCGCAACGGAGAGCTCCACCAATGCTAACACTCGCACCACGGTCTTCTTCCGATACATTCCTCACTGAAATTAGCCCTGGCCCCATGACACTTGTCTCCAATTTCTTCTCCGATCACTACCCTGACGCTGATCTCCGTTCCCTCTCTCAGCTTCTCGCCGGAGTCATACCTTCCCCCACCGCTGAATACCCGCCTCCACATTGCAGTGACGCACCTCTTTTATCCGCGGA...

Protein

Download Protein FASTA

333 aa · LXL04_024137|LXL04_024137|OH1004|PROTEIN

MANTGGDLAPPQRRAPPMLTLAPRSSSDTFLTEISPGPMTLVSNFFSDHYPDADLRSLSQLLAGVIPSPTAEYPPPHCSDAPLLSAEESLTPQTSDPDESQIRSPENAALSQSDDSMPEPVVGLSQPDGDGYNWRKYGQKQVKASELPRSYYRCKQINCKVTKKIGHFLDGSTSEIIYSGRHNHEPPELQKPVDADEKVINQRMPKRRQIFYRGLIVCRKSEGRCVDRSDTCRVVVTDPKIVVQTKSVIDVLEDGFKWRK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024137`
TK1151 ID	TkA06G173400
OH-1004 ID	LXL04_024137
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.400
Protein coverage (%)	TK1151 93.665 / OH-1004 69.970 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024137

Location Chr05:82127828-82130581 (-)

Description Similar to WRKY58: Probable WRKY transcription factor 58

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01080`	Transcription factor.	No verified direct reference in this release
`At2g03340`	Transcription factor.	No verified direct reference in this release
`At1g13960`	Transcription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis- acting element.	Roles of Arabidopsis WRKY3 and WRKY4 transcription factors in plant responses to pathogens.2008 · DOI: 10.1186/1471-2229-8-68 Structural basis for sequence-specific DNA recognition by an Arabidopsis WRKY transcription factor.2012 · DOI: 10.1074/jbc.m111.279844
`At5g07100`	Transcription factor.	Arabidopsis thaliana WRKY25, WRKY26, and WRKY33 coordinate induction of plant thermotolerance.2011 · DOI: 10.1007/s00425-011-1375-2

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q6B6R4`	Transcription repressor (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024137 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT2G03340

ath:AT3G01080

ath:AT5G07100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.909

Rank 1 · LXL04_024137 · OH-1004

Cytoplasm0.203

Rank 2 · LXL04_024137 · OH-1004

Mitochondrion0.028

Rank 3 · LXL04_024137 · OH-1004

Cell membrane0.020

Rank 4 · LXL04_024137 · OH-1004

Endoplasmic reticulum0.010

Rank 5 · LXL04_024137 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03106.22WRKY130-185 aa

PF03106.22WRKY253-310 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024137	`PF03106.22`	WRKY	130	185	3.3e-46	156.0
LXL04_024137	`PF03106.22`	WRKY	253	310	3.3e-46	156.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93WU7`	Arabidopsis thaliana	Probable WRKY transcription factor 58	36.646%	Swiss-Prot	moderate database homology
`Q9ZQ70`	Arabidopsis thaliana	Probable WRKY transcription factor 3	44.541%	Swiss-Prot	moderate database homology
`Q9XI90`	Arabidopsis thaliana	Probable WRKY transcription factor 4	33.156%	Swiss-Prot	moderate database homology
`Q9C5T3`	Arabidopsis thaliana	Probable WRKY transcription factor 26	46.000%	Swiss-Prot	moderate database homology
`Q6B6R4`	Oryza sativa subsp. indica	WRKY transcription factor WRKY24	43.277%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card