TkA06G131850 | RubberDandelionOmics

Gene overview

TkA06G131850

Reference: TK1151 Chr: Chr06 Coordinates: 34460253-34460826 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

348 bp · TkA06G131850|TK1151|cDNA

TTTCACATTTAGGGTTAAATGAGATTGAGCGCCGTTTTTCCTCGCGACTCCTCTCCTCCTTCTCTATTTTCCATCGCTGGAGCCTGGAAGCAATCGCGAGACCGCCGTTTTCCATCGCCTGCATCGACCTCCGCTGGAAGCAATCGCGAAGCAGGAAGCAATCGCGACTCCTCTCCTCCTTCTTTGTTCTCTCCGGCTCCTGCATCTTCTAAGTTATTATGTTTCACTCATGATCTTCGTTCGCAGAGTTATTTTCCGTC...

CDS

Download CDS FASTA

330 bp · TkA06G131850|TK1151|CDS

ATGAGATTGAGCGCCGTTTTTCCTCGCGACTCCTCTCCTCCTTCTCTATTTTCCATCGCTGGAGCCTGGAAGCAATCGCGAGACCGCCGTTTTCCATCGCCTGCATCGACCTCCGCTGGAAGCAATCGCGAAGCAGGAAGCAATCGCGACTCCTCTCCTCCTTCTTTGTTCTCTCCGGCTCCTGCATCTTCTAAGTTATTATGTTTCACTCATGATCTTCGTTCGCAGAGTTATTTTCCGTCAATGACGAAGATCGTTGG...

Protein

Download Protein FASTA

110 aa · TkA06G131850|TK1151|PROTEIN

MRLSAVFPRDSSPPSLFSIAGAWKQSRDRRFPSPASTSAGSNREAGSNRDSSPPSLFSPAPASSKLLCFTHDLRSQSYFPSMTKIVGTLGPKSRSVEVISRCLMAGMSGN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G131850`
TK1151 ID	TkA06G131850
OH-1004 ID	LXL04_024551
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 85.938 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G131850

Location Chr06:34460253-34460826 (-)

Description Similar to Os12g0145700: Pyruvate kinase 2, cytosolic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BM17`	Key regulatory enzyme of the glycolytic pathway that catalyzes the final step of glycolysis, converting ADP and phosphoenolpyruvate (PEP) to ATP and pyruvate by essentially irreversible transphosphorylation.	No verified direct reference in this release
`Os12g0145700`	Key regulatory enzyme of the glycolytic pathway that catalyzes the final step of glycolysis, converting ADP and phosphoenolpyruvate (PEP) to ATP and pyruvate by essentially irreversible transphosphorylation.	No verified direct reference in this release
`UniProt: B8BJ39`	Key regulatory enzyme of the glycolytic pathway that catalyzes the final step of glycolysis, converting ADP and phosphoenolpyruvate (PEP) to ATP and pyruvate by essentially irreversible transphosphorylation.	No verified direct reference in this release
`Os11g0148500`	Key regulatory enzyme of the glycolytic pathway that catalyzes the final step of glycolysis, converting ADP and phosphoenolpyruvate (PEP) to ATP and pyruvate by essentially irreversible transphosphorylation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024551 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004743 pyruvate kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016301 kinase activity Molecular Function

GO:0030955 potassium ion binding Molecular Function

KEGG gene cross-reference

dosa:Os11g0148500

dosa:Os12g0145700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.422

Rank 1 · TkA06G131850 · TK1151

Cytoplasm0.402

Rank 2 · TkA06G131850 · TK1151

Cell membrane0.157

Rank 3 · TkA06G131850 · TK1151

Endoplasmic reticulum0.096

Rank 4 · TkA06G131850 · TK1151

Mitochondrion0.075

Rank 5 · TkA06G131850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00224PK83-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G131850	`PF00224`	PK	83	107	0.0081	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B8BM17`	Oryza sativa subsp. indica	sp\|B8BM17\|KPYC2_ORYSI Pyruvate kinase 2, cytosolic	81.300%	Swiss-Prot	Low
`Q2QXR8`	Oryza sativa subsp. japonica	sp\|Q2QXR8\|KPYC2_ORYSJ Pyruvate kinase 2, cytosolic	81.300%	Swiss-Prot	Low
`B8BJ39`	Oryza sativa subsp. indica	sp\|B8BJ39\|KPYC1_ORYSI Pyruvate kinase 1, cytosolic	78.100%	Swiss-Prot	Low
`Q2RAK2`	Oryza sativa subsp. japonica	sp\|Q2RAK2\|KPYC1_ORYSJ Pyruvate kinase 1, cytosolic	78.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card