TkA06G094820 | RubberDandelionOmics

Gene overview

TkA06G094820

Reference: TK1151 Chr: Chr06 Coordinates: 25212441-25218100 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

914 bp · TkA06G094820|TK1151|cDNA

TTTCACTACCTGAAGCAACCTCTATAATCTATTGTCATCTGTGTCGGTAGTACCTTCAAAATGGTAGTCATGGCTGCTGATGCTAAACCCACCTTCTCTCTCCTCTTACTCGCCAGGATCTCAGCTTCACTCGTCGCCATTCTTCTTCTCACTTGGGCTCTCTACTTCACCACCAGCTTCCTTCCTCACACACTCTCTCAGCGAGACCTCATTTACTCTGTTCTGCATCCTTTATTAATGGTGATTGGATTCATTCTCAT...

CDS

Download CDS FASTA

789 bp · TkA06G094820|TK1151|CDS

ATGTCAGATGGCTTCAGTTGCGGGTATGAGAGCTCGATGCCTCGAATTTACGACTTATTTAATGAGATTGGTTTGACCTTTGAAAACAATCGGAGCTACGAGAAAAGGATCTCAGCTTCACTCGTCGCCATTCTTCTTCTCACTTGGGCTCTCTACTTCACCACCAGCTTCCTTCCTCACACACTCTCTCAGCGAGACCTCATTTACTCTGTTCTGCATCCTTTATTAATGGTGATTGGATTCATTCTCATAAGCGGAGA...

Protein

Download Protein FASTA

262 aa · TkA06G094820|TK1151|PROTEIN

MSDGFSCGYESSMPRIYDLFNEIGLTFENNRSYEKRISASLVAILLLTWALYFTTSFLPHTLSQRDLIYSVLHPLLMVIGFILISGEAILVHRWLPGSRKRKKRVHLWLQGVALASAIFGIWTKFQGREGVVANFYSLHSWMGLLCVSLFGAQWLMGFVNFWHRGEVRMTRIQVLPWHVFLGLYTYGLAVVTAETGLLEKLTFLQTNGLVLKHCTESMIVNGLGLGLATLCGVVILTAVSPKPYQTTLATKAVYSDTKCL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G094820`
TK1151 ID	TkA06G094820
OH-1004 ID	LXL04_024940
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G094820

Location Chr06:25212441-25218100 (-)

Description Similar to CYB561D: Probable transmembrane ascorbate ferrireductase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26100`	Two-heme-containing cytochrome.	No verified direct reference in this release
`At5g38630`	Two-heme-containing cytochrome.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0533500`	Two-heme-containing cytochrome.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024940 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0019852 L-ascorbic acid metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0000293 ferric-chelate reductase activity Molecular Function

GO:0009055 electron transfer activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0019904 protein domain specific binding Molecular Function

KEGG gene cross-reference

ath:AT1G26100

ath:AT4G25570

ath:AT5G38630

zma:100273009

zma:100384594

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.286

Rank 1 · TkA06G094820 · TK1151

Endoplasmic reticulum0.258

Rank 2 · TkA06G094820 · TK1151

Lysosome / Vacuole0.217

Rank 3 · TkA06G094820 · TK1151

Cytoplasm0.202

Rank 4 · TkA06G094820 · TK1151

Golgi apparatus0.197

Rank 5 · TkA06G094820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20990DUF2207_C27-86 aa

PF29362TMEM3131-84 aa

PF03188Cytochrom_B56140-61 aa

PF07444Ycf66_N43-84 aa

PF03188Cytochrom_B56172-203 aa

PF11297DUF309875-88 aa

PF09990DUF223198-154 aa

PF09990DUF223199-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G094820	`PF20990`	DUF2207_C	27	86	0.33	11.3
TkA06G094820	`PF29362`	TMEM31	31	84	0.0084	17.6
TkA06G094820	`PF03188`	Cytochrom_B561	40	61	1.1e-41	143.0
TkA06G094820	`PF07444`	Ycf66_N	43	84	1.1	10.1
TkA06G094820	`PF03188`	Cytochrom_B561	72	203	1.1e-41	143.0
TkA06G094820	`PF11297`	DUF3098	75	88	0.15	12.4
TkA06G094820	`PF09990`	DUF2231	98	154	2.9	8.7
TkA06G094820	`PF09990`	DUF2231	99	196	2.9	8.7
TkA06G094820	`PF20990`	DUF2207_C	101	156	0.33	11.3
TkA06G094820	`PF07444`	Ycf66_N	138	146	1.1	10.1
TkA06G094820	`PF11297`	DUF3098	169	191	0.15	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C540`	Arabidopsis thaliana	sp\|Q9C540\|ACFR4_ARATH Probable transmembrane ascorbate ferrireductase 4	65.700%	Swiss-Prot	High
`Q9SWS1`	Arabidopsis thaliana	sp\|Q9SWS1\|ACFR2_ARATH Transmembrane ascorbate ferrireductase 2	44.200%	Swiss-Prot	Medium
`Q7XMK3`	Oryza sativa subsp. japonica	sp\|Q7XMK3\|ACET2_ORYSJ Probable ascorbate-specific transmembrane electron transporter 2	40.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card