LXL04_024940 | RubberDandelionOmics

Gene overview

LXL04_024940

Reference: OH-1004 Chr: Chr05 Coordinates: 102502431-102505471 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

855 bp · LXL04_024940|LXL04_024940|OH1004|cDNA

ATGTCAGATGGCTTCAGTTGCGGGTATGAGAGCTCGATGCCTCGAATTTACGACTTATTTAATGAGATTGGTTTGACCTTTGAAAACAATCGGAGCTACGAGAAAAGTACCTTCAAAATGGTAGTCATGGCTGCTGATGCTAAACCCACCTTCTCTCTCCTCTTACTGGCCAGGATCTCAGCTTCACTCGTCGCCATTCTTCTTCTCACTTGGGCTCTCTACTTCACCACCAGCTTCCTTCCTCACACACTCTCTCAGCG...

CDS

Download CDS FASTA

855 bp · LXL04_024940|LXL04_024940|OH1004|CDS

ATGTCAGATGGCTTCAGTTGCGGGTATGAGAGCTCGATGCCTCGAATTTACGACTTATTTAATGAGATTGGTTTGACCTTTGAAAACAATCGGAGCTACGAGAAAAGTACCTTCAAAATGGTAGTCATGGCTGCTGATGCTAAACCCACCTTCTCTCTCCTCTTACTGGCCAGGATCTCAGCTTCACTCGTCGCCATTCTTCTTCTCACTTGGGCTCTCTACTTCACCACCAGCTTCCTTCCTCACACACTCTCTCAGCG...

Protein

Download Protein FASTA

284 aa · LXL04_024940|LXL04_024940|OH1004|PROTEIN

MSDGFSCGYESSMPRIYDLFNEIGLTFENNRSYEKSTFKMVVMAADAKPTFSLLLLARISASLVAILLLTWALYFTTSFLPHTLSQRDLIYSVLHPLLMVIGFILISGEAILVHRWLPGSRKRKKRVHLWLQGVALASAIFGIWTKFQGREGVVANFYSLHSWMGLLCVSLFGAQWLMGFVNFWHRGEVRMTRIHVLPWHVFLGLYTYGLAVVTAETGLLEKLTFLQTNGLVSKHCTESMIVNGLGLGLATLCGVVILTA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024940`
TK1151 ID	TkA06G094820
OH-1004 ID	LXL04_024940
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024940

Location Chr05:102502431-102505471 (+)

Description Similar to CYB561D: Probable transmembrane ascorbate ferrireductase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26100`	Two-heme-containing cytochrome.	No verified direct reference in this release
`At5g38630`	Two-heme-containing cytochrome.	No verified direct reference in this release
`At4g25570`	Two-heme-containing cytochrome.	Localization of an ascorbate-reducible cytochrome b561 in the plant tonoplast.2004 · DOI: 10.1104/pp.103.032359

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024940 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0019852 L-ascorbic acid metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0000293 ferric-chelate reductase activity Molecular Function

GO:0009055 electron transfer activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0019904 protein domain specific binding Molecular Function

KEGG gene cross-reference

ath:AT1G26100

ath:AT4G25570

ath:AT5G38630

zma:100273009

zma:100384594

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.314

Rank 1 · LXL04_024940 · OH-1004

Lysosome / Vacuole0.282

Rank 2 · LXL04_024940 · OH-1004

Endoplasmic reticulum0.210

Rank 3 · LXL04_024940 · OH-1004

Cytoplasm0.187

Rank 4 · LXL04_024940 · OH-1004

Golgi apparatus0.171

Rank 5 · LXL04_024940 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03188.22Cytochrom_B56194-225 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024940	`PF03188.22`	Cytochrom_B561	94	225	3.5e-41	141.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C540`	Arabidopsis thaliana	Probable transmembrane ascorbate ferrireductase 4	64.490%	Swiss-Prot	strong database homology
`Q9SWS1`	Arabidopsis thaliana	Transmembrane ascorbate ferrireductase 2	42.060%	Swiss-Prot	moderate database homology
`Q8L856`	Arabidopsis thaliana	Transmembrane ascorbate ferrireductase 1	40.291%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card