TkA06G085010 | RubberDandelionOmics

Gene overview

TkA06G085010

Reference: TK1151 Chr: Chr06 Coordinates: 22709600-22712974 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2062 bp · TkA06G085010|TK1151|cDNA

CTTCACACTACATACACCACCCAATCATTATCACATTCACACTCAATATATATGAATCTAATTCCATCATTACACTAACCTCCTCATACAAATTCCTCTCTCCCTCTCTCTCCATCTTTCTTACACCCACTTAGTGTGTGTATTCATGTTCATGCAGGTTTAGAGAAGGGCAAAATTGGAACAAAAATGATTTATACCTTTCTTCTAGTTCATGTTTTGGCCCTGTTTGGGTTTGTTTTGGGGGATGTAGGGCTCGTGAG...

CDS

Download CDS FASTA

1710 bp · TkA06G085010|TK1151|CDS

ATGATTTATACCTTTCTTCTAGTTCATGTTTTGGCCCTGTTTGGGTTTGTTTTGGGGGATGTAGGGCTCGTGAGTCCATCTCAATTGGAAATGTTTGTGGATGAAATTCCAGATATGCCCAGAATCAAAGGCTATGATGTTCTTCATGGTGTTCCTGTTTTCAAAACTCTCAAGATCTCCATGTATCAGAAGTCTTGGAAATTCCACAAGGATCTCCCAAAAACCAAGGTGTTCGCATTCGGTGAAACGAGGCGCACTGC...

Protein

Download Protein FASTA

569 aa · TkA06G085010|TK1151|PROTEIN

MIYTFLLVHVLALFGFVLGDVGLVSPSQLEMFVDEIPDMPRIKGYDVLHGVPVFKTLKISMYQKSWKFHKDLPKTKVFAFGETRRTATVPGPTIETVHGVSTHVTWQNLLPSKHILPWDPTIPTAIPRTKNGVPTVVHLHGGIDEPESDGNSNSWFTARFKERGPMWTKKTYHYHNQQQPGNLYYHDHAMGLTRVNLLAGLFGAYIIRHHEVESPLRLPSGDEFDRPLVVFDRSFLSNGSLYMDPTGNNPSIHPQWQPEY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G085010`
TK1151 ID	TkA06G085010
OH-1004 ID	LXL04_025046
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G085010

Location Chr06:22709600-22712974 (-)

Description Similar to LPR1: Multicopper oxidase LPR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g23010`	Multicopper oxidase that may be involved in copper homeostasis and oxidative stress response, and that is necessary for root growth inhibition by low phosphate conditions.	No verified direct reference in this release
`At1g71040`	Multicopper oxidase that may be involved in copper homeostasis and oxidative stress response, and that is necessary for root growth inhibition by low phosphate conditions.	Root tip contact with low-phosphate media reprograms plant root architecture.2007 · DOI: 10.1038/ng2041

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0126100`	Multicopper oxidase that may play a role in the maintenance of inorganic phosphate homeostasis.	No verified direct reference in this release
`Os01g0126200`	Multicopper oxidase that may play a role in the maintenance of inorganic phosphate homeostasis.	No verified direct reference in this release
`Os01g0126900`	Multicopper oxidase that may play a role in the maintenance of inorganic phosphate homeostasis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025046 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010073 meristem maintenance Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016682 oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor Molecular Function

KEGG gene cross-reference

ath:AT1G23010

ath:AT1G71040

dosa:Os01g0126100

dosa:Os01g0126200

dosa:Os01g0126900

osa:4326010

osa:4326011

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.785

Rank 1 · TkA06G085010 · TK1151

Cell membrane0.073

Rank 2 · TkA06G085010 · TK1151

Cytoplasm0.069

Rank 3 · TkA06G085010 · TK1151

Endoplasmic reticulum0.049

Rank 4 · TkA06G085010 · TK1151

Lysosome / Vacuole0.041

Rank 5 · TkA06G085010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07732Cu-oxidase_388-119 aa

PF07732Cu-oxidase_3134-210 aa

PF07731Cu-oxidase_2152-175 aa

PF07732Cu-oxidase_3263-291 aa

PF00394Cu-oxidase274-344 aa

PF07731Cu-oxidase_2411-565 aa

PF07732Cu-oxidase_3533-556 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G085010	`PF07732`	Cu-oxidase_3	88	119	4.6e-06	27.4
TkA06G085010	`PF07732`	Cu-oxidase_3	134	210	4.6e-06	27.4
TkA06G085010	`PF07731`	Cu-oxidase_2	152	175	1.3e-10	41.8
TkA06G085010	`PF07732`	Cu-oxidase_3	263	291	4.6e-06	27.4
TkA06G085010	`PF00394`	Cu-oxidase	274	344	3.2e-05	24.8
TkA06G085010	`PF07731`	Cu-oxidase_2	411	565	1.3e-10	41.8
TkA06G085010	`PF07732`	Cu-oxidase_3	533	556	4.6e-06	27.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I4K5`	Arabidopsis thaliana	sp\|F4I4K5\|LPR1_ARATH Multicopper oxidase LPR1	68.800%	Swiss-Prot	High
`Q949X9`	Arabidopsis thaliana	sp\|Q949X9\|LPR2_ARATH Multicopper oxidase LPR2	67.400%	Swiss-Prot	High
`Q9AWU4`	Oryza sativa subsp. japonica	sp\|Q9AWU4\|LPR1_ORYSJ Multicopper oxidase LPR1 homolog 1	58.300%	Swiss-Prot	High
`Q5ZE07`	Oryza sativa subsp. japonica	sp\|Q5ZE07\|LPR2_ORYSJ Multicopper oxidase LPR1 homolog 2	55.400%	Swiss-Prot	High
`Q7F757`	Oryza sativa subsp. japonica	sp\|Q7F757\|LPR4_ORYSJ Multicopper oxidase LPR1 homolog 4	54.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card