Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1103 bp · TkA06G047280|TK1151|cDNA
GAAATCAAGTTTCTCTCGTAGTTGGCTGTCTAGATAAATCAAGGCTCAACGCAGATTCTGCAATCGACCACTTTCCCCATCTTCTTCAATCGACGCAGAATTCCTCCAGTAGGATCACAGAAACCTCTCGCACCAAGCTATAATTCAAAGAACGTTAAGGGAAGAGGAGCGTCTTCGCAAGCAACGACAACCGCATTTCATAATTCCATGGCTCTGGACAATAAATATAGGCTTGGACATGAGATCAGGAGAGGAGCATA...
4383 bp · TkA06G047280|TK1151|CDS
CATACAACGAAAAAGATAAAGAAAAACAAAAGTAGATTAGTCTCTTTTCAAACGGTAAATCATCGACACTCAAAGCCCCCGGCAAAAAAAAAAAAAACCCCATCGAATAAATGCTTGTTGACAACTGTATTTCGTTTGCCCCTGCTTTTTCTCAATAGCTCAACGCAGATTCTGCAATCGACCACTTTCCCCATCTTCTTCAATCGACGCAGAATTCCTCCAGTAGGATCACAGAAACCTCTCGCACCAAGCTATAATTC...
Protein
Download Protein FASTA1460 aa · TkA06G047280|TK1151|PROTEIN
HTTKKIKKNKSRLVSFQTVNHRHSKPPAKKKKTPSNKCLLTTVFRLPLLFLNSSTQILQSTTFPIFFNRRRIPPVGSQKPLAPSYNSKNVKGRGASSQATTTAFHNSMALDNKYRLGHEIRRGAYGRVYKGLDLKKGDFVAIEQVSLQNSSEENLNNIMKQIDLHKELNHKNIIKCIGSFTTDTHLNIVLEYVENESLANIIKPDNFGPLPERLVAFYISQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G047280 |
|---|---|
| TK1151 ID | TkA06G047280 |
| OH-1004 ID | LXL04_025656 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 84.100 |
| Protein coverage (%) | TK1151 98.082 / OH-1004 88.989Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G047280 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:12779544-12791083 (+) | |||||||||
| Description | Similar to M3KE1: MAP3K epsilon protein kinase 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000165 MAPK cascade Biological Process GO:0045995 regulation of embryonic development Biological Process GO:0046777 protein autophosphorylation Biological Process GO:0051301 cell division Biological Process GO:0051302 regulation of cell division Biological Process GO:0051510 regulation of unidimensional cell growth Biological Process GO:0061387 regulation of extent of cell growth Biological Process GO:0005730 nucleolus Cellular Component GO:0005773 vacuole Cellular Component GO:0005815 microtubule organizing center Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G07980 ath:AT3G13530 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00069Pkinase114-368 aaPF07714PK_Tyr_Ser-Thr116-364 aaPF13095FTA2145-247 aaPF24768ARM_ARMC5150-180 aaPF03109ABC1188-267 aaPF17667Pkinase_fungal220-286 aaPF02985HEAT319-332 aaPF17667Pkinase_fungal475-550 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G047280 | PF00069 | Pkinase | 114 | 368 | 3.6e-68 | 230.5 |
| TkA06G047280 | PF07714 | PK_Tyr_Ser-Thr | 116 | 364 | 3e-45 | 155.3 |
| TkA06G047280 | PF13095 | FTA2 | 145 | 247 | 0.096 | 13.1 |
| TkA06G047280 | PF24768 | ARM_ARMC5 | 150 | 180 | 6.4e-08 | 33.0 |
| TkA06G047280 | PF03109 | ABC1 | 188 | 267 | 0.0075 | 16.2 |
| TkA06G047280 | PF17667 | Pkinase_fungal | 220 | 286 | 0.0006 | 19.4 |
| TkA06G047280 | PF02985 | HEAT | 319 | 332 | 0.04 | 14.9 |
| TkA06G047280 | PF17667 | Pkinase_fungal | 475 | 550 | 0.0006 | 19.4 |
| TkA06G047280 | PF24768 | ARM_ARMC5 | 671 | 818 | 6.4e-08 | 33.0 |
| TkA06G047280 | PF00514 | Arm | 708 | 734 | 0.13 | 13.1 |
| TkA06G047280 | PF21581 | SCD | 767 | 798 | 0.29 | 12.1 |
| TkA06G047280 | PF02985 | HEAT | 773 | 792 | 0.04 | 14.9 |
| TkA06G047280 | PF00514 | Arm | 799 | 815 | 0.13 | 13.1 |
| TkA06G047280 | PF00514 | Arm | 854 | 870 | 0.13 | 13.1 |
| TkA06G047280 | PF00514 | Arm | 988 | 998 | 0.13 | 13.1 |
| TkA06G047280 | PF24768 | ARM_ARMC5 | 1158 | 1304 | 6.4e-08 | 33.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.