TkA06G042190 | RubberDandelionOmics

Gene overview

TkA06G042190

Reference: TK1151 Chr: Chr06 Coordinates: 11406092-11407186 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

590 bp · TkA06G042190|TK1151|cDNA

TTACGGGTTACCTACGAAATTTACCCAAACCACAATATCAATCGCTATTCGCTACATTTCAGTTCCTACAGAGTCTTAAATTCCCTCTCATCAGCTTCAACAATGGATTGGCAAGGACAGAAGCTAGCAGAACAGCTGATGCAAATAGTGCTGGTGTTGTTTGCCATTGGAGCGTTCATAACGGGGTATATCATGGGATCATTTCAACTGATGCTGTTCATATACGCTGGAGGTGTTGTTCTAACTACTCTAATCACCAT...

CDS

Download CDS FASTA

381 bp · TkA06G042190|TK1151|CDS

TTACGGGTTACCTACGAAATTTACCCAAACCACAATATCAATCGCTATTCGCTACATTTCAGTTCCTACAGAGTCTTAAATTCCCTCTCATCAGCTTCAACAATGGATTGGCAAGGACAGAAGCTAGCAGAACAGCTGATGCAAATAGTGCTGGTGTTGTTTGCCATTGGAGCGTTCATAACGGGGTATATCATGGGATCATTTCAACTGATGCTGTTCATATACGCTGGAGGTGTTGTTCTAACTACTCTAATCACCAT...

Protein

Download Protein FASTA

126 aa · TkA06G042190|TK1151|PROTEIN

LRVTYEIYPNHNINRYSLHFSSYRVLNSLSSASTMDWQGQKLAEQLMQIVLVLFAIGAFITGYIMGSFQLMLFIYAGGVVLTTLITIPNWPFFNRHSLKWLDPSEVEKHPKPQVTGLIAKKKPTKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G042190`
TK1151 ID	TkA06G042190
OH-1004 ID	LXL04_025764
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 97.674 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G042190

Location Chr06:11406092-11407186 (-)

Description Similar to At2g22425: Probable signal peptidase complex subunit 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22425`	Component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025764 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006465 signal peptide processing Biological Process

GO:0019068 virion assembly Biological Process

GO:0019082 viral protein processing Biological Process

GO:0045047 protein targeting to ER Biological Process

GO:0005787 signal peptidase complex Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0043022 ribosome binding Molecular Function

KEGG gene cross-reference

ath:AT2G22425

bta:511453

cfa:476592

mmu:69019

ssc:100135675

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.717

Rank 1 · TkA06G042190 · TK1151

Nucleus0.146

Rank 2 · TkA06G042190 · TK1151

Golgi apparatus0.132

Rank 3 · TkA06G042190 · TK1151

Cytoplasm0.100

Rank 4 · TkA06G042190 · TK1151

Cell membrane0.061

Rank 5 · TkA06G042190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06645SPC1235-104 aa

PF13789DUF418139-95 aa

PF05884ZYG-11_interact47-85 aa

PF11808PhoR50-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G042190	`PF06645`	SPC12	35	104	1.2e-30	106.1
TkA06G042190	`PF13789`	DUF4181	39	95	0.066	14.4
TkA06G042190	`PF05884`	ZYG-11_interact	47	85	0.018	15.2
TkA06G042190	`PF11808`	PhoR	50	85	7.0	7.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q944J0`	Arabidopsis thaliana	sp\|Q944J0\|SPCS1_ARATH Signal peptidase complex subunit 1	66.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card