LXL04_025764 | RubberDandelionOmics

Gene overview

LXL04_025764

Reference: OH-1004 Chr: Chr05 Coordinates: 116722783-116723901 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

390 bp · LXL04_025764|LXL04_025764|OH1004|cDNA

ATGAAAAAGTTACGGGTTACCTACGAAATTTACCCAAACCACAATATCAATCGCTATTCGCTACATTTCAGTTCCTACAGAGTCTTAAATTCCCTCTCATCAGCTTCAACAATGGATTGGCAAGGACAGAAGCTAGCAGAACAGCTGATGCAAATAGTGCTGGTGTTGTTTGCCATTGGAGCGTTCATAACGGGGTATATCATGGGATCATTTCAACTGATGCTGTTCATATACGCTGGAGGTGTTGTTCTAACTACTCT...

CDS

Download CDS FASTA

390 bp · LXL04_025764|LXL04_025764|OH1004|CDS

ATGAAAAAGTTACGGGTTACCTACGAAATTTACCCAAACCACAATATCAATCGCTATTCGCTACATTTCAGTTCCTACAGAGTCTTAAATTCCCTCTCATCAGCTTCAACAATGGATTGGCAAGGACAGAAGCTAGCAGAACAGCTGATGCAAATAGTGCTGGTGTTGTTTGCCATTGGAGCGTTCATAACGGGGTATATCATGGGATCATTTCAACTGATGCTGTTCATATACGCTGGAGGTGTTGTTCTAACTACTCT...

Protein

Download Protein FASTA

129 aa · LXL04_025764|LXL04_025764|OH1004|PROTEIN

MKKLRVTYEIYPNHNINRYSLHFSSYRVLNSLSSASTMDWQGQKLAEQLMQIVLVLFAIGAFITGYIMGSFQLMLFIYAGGVVLTTLITIPNWPFFNRHSLKWLDPSEVEKHPKPQVTGLIAKKKPTKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025764`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025764

Location Chr05:116722783-116723901 (+)

Description Similar to At2g22425: Probable signal peptidase complex subunit 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22425`	Component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025764 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006465 signal peptide processing Biological Process

GO:0019068 virion assembly Biological Process

GO:0019082 viral protein processing Biological Process

GO:0045047 protein targeting to ER Biological Process

GO:0005787 signal peptidase complex Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0043022 ribosome binding Molecular Function

KEGG gene cross-reference

ath:AT2G22425

bta:511453

cfa:476592

mmu:69019

ssc:100135675

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.700

Rank 1 · LXL04_025764 · OH-1004

Nucleus0.148

Rank 2 · LXL04_025764 · OH-1004

Golgi apparatus0.134

Rank 3 · LXL04_025764 · OH-1004

Cytoplasm0.105

Rank 4 · LXL04_025764 · OH-1004

Cell membrane0.065

Rank 5 · LXL04_025764 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06645.19SPC1238-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025764	`PF06645.19`	SPC12	38	107	1.3e-30	106.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q944J0`	Arabidopsis thaliana	Signal peptidase complex subunit 1	66.304%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card