RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G042180
Reference: TK1151 Chr: Chr06 Coordinates: 11388102-11403916 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1859 bp · TkA06G042180|TK1151|cDNA

AAAAGTCTCCCCAAAACCCAACGATAAAAAAAGATTTTTAAAAGACAAGTGAAAACCAAAGACTGAAATCTGGGACGCGTACCCAGAGGGCTGAGAATGAACACCGGAGATCATATATCGACGTCGACCACCTGCTTCCGCCAGCTTATCCTTCCCCTTTCCCACCTTCTGCCAGCTTGTTTGACCGATTCCTGGGACAATTCTCAAAGAAGACGCCGTCGTTTTCTTGCTCACATCATCGGAGGCTCCCACCTTTGAAG...

CDS

Download CDS FASTA

2310 bp · TkA06G042180|TK1151|CDS

ATGGGGAGTTGGGGGTGGTGGCAAGAGTACTCTTGCTTCTTACTCCCTCCGTCCCATATTTACAATTTTGATAGTTGTTGTTTTGTAAAAAATATTCGGGAAGAAGCAAGCTATCATGGTTTGGAAAAGTTGCAAGAAAAACTCCTTATAGGTATTTTGAAAAAGCAAGTGCGGGAGGTAAGGAGAGTTGAGGAAGGAAGACGCATGATAATGGCTAGGCTAGGCCATAAAAAGGTGTTGATTGTTCTTGATGATGTCGA...

Protein

Download Protein FASTA

769 aa · TkA06G042180|TK1151|PROTEIN

MGSWGWWQEYSCFLLPPSHIYNFDSCCFVKNIREEASYHGLEKLQEKLLIGILKKQVREVRRVEEGRRMIMARLGHKKVLIVLDDVDQVDQLRALVGSCDWFGEGSRIIITTRNEQLLNAHGVVLIQHISLLNNHEASRLFYKHAHRDRKPTEVFEKLSKEVVSYADGLPLALKVLGSFLCGRNSTQWRSAIDKLKDIPNKDIIGILRISFDGLEQDEKDMFLDIACFFRRKMKDRAMKVFDACGSHSAIGVEVLRQKAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G042180
TK1151 IDTkA06G042180
OH-1004 IDLXL04_025767
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)98.900
Protein coverage (%)TK1151 97.789 / OH-1004 76.619
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G042180
LocationChr06:11388102-11403916 (+)
DescriptionSimilar to ROQ1: Disease resistance protein Roq1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g67490 Cleaves the distal alpha 1,2-linked glucose residue from the Glc(3)Man(9)GlcNAc(2) oligosaccharide precursor. No verified direct reference in this release
At1g24320 Alpha-glucosidase 2. No verified direct reference in this release
At4g12010 TIR-NB-LRR receptor-like protein involved in plant defense.
Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.2017 · DOI: 10.1016/j.chom.2017.03.005
At4g16950 TIR-NB-LRR receptor-like protein that confers resistance to the pathogen Hyaloperonospora arabidopsis isolate Noco2 (downy mildew disease). No verified direct reference in this release
At4g11170 Putative disease resistance protein At4g11170. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_025767 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0007165 signal transduction Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0019677 NAD+ catabolic process Biological Process
GO:0043068 positive regulation of programmed cell death Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0003953 NAD+ nucleosidase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0042803 protein homodimerization activity Molecular Function
GO:0043531 ADP binding Molecular Function
KEGG gene cross-referenceNo functional description available
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.449
Rank 1 · TkA06G042180 · TK1151
Cytoplasm0.383
Rank 2 · TkA06G042180 · TK1151
Cell membrane0.191
Rank 3 · TkA06G042180 · TK1151
Endoplasmic reticulum0.093
Rank 4 · TkA06G042180 · TK1151
Plastid0.046
Rank 5 · TkA06G042180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00931NB-ARC22-147 aa
PF23282WHD_ROQ1215-286 aa
PF25013LRR_Zer-1325-355 aa
PF23598LRR_14327-424 aa
PF13855LRR_8340-352 aa
PF12799LRR_4349-362 aa
PF29594LRR_SKP2371-496 aa
PF13855LRR_8374-426 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G042180PF00931NB-ARC221471.6e-0938.3
TkA06G042180PF23282WHD_ROQ12152863.8e-1659.7
TkA06G042180PF25013LRR_Zer-13253550.005917.5
TkA06G042180PF23598LRR_143274240.0004319.9
TkA06G042180PF13855LRR_83403527.8e-0626.3
TkA06G042180PF12799LRR_43493623.8e-0834.1
TkA06G042180PF29594LRR_SKP23714960.1811.8
TkA06G042180PF13855LRR_83744267.8e-0626.3
TkA06G042180PF25019LRR_R13L1-DRL213864260.0001222.7
TkA06G042180PF23952LRR_EndoS3874540.05214.5
TkA06G042180PF25013LRR_Zer-13914460.005917.5
TkA06G042180PF23247LRR_RPS23914350.3511.5
TkA06G042180PF23286LRR_133924594e-0524.1
TkA06G042180PF12799LRR_43954323.8e-0834.1
TkA06G042180PF23598LRR_144084680.0004319.9
TkA06G042180PF25013LRR_Zer-14145000.005917.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4HTM3Arabidopsis thalianasp|F4HTM3|GCS1_ARATH Mannosyl-oligosaccharide glucosidase GCS158.100%Swiss-ProtHigh
Q84M89Arabidopsis thalianasp|Q84M89|GCS2_ARATH Alpha-glucosidase 260.300%Swiss-ProtHigh
Q9SZ66Arabidopsis thalianasp|Q9SZ66|DSC1_ARATH Disease resistance-like protein DSC132.300%Swiss-ProtMedium
F4JNB7Arabidopsis thalianasp|F4JNB7|RPP5_ARATH Disease resistance protein RPP532.700%Swiss-ProtMedium
O82500Arabidopsis thalianasp|O82500|Y4117_ARATH Putative disease resistance protein At4g1117042.200%Swiss-ProtMedium

JBrowse

View in Genome Browser