LXL04_025767 | RubberDandelionOmics

Gene overview

LXL04_025767

Reference: OH-1004 Chr: Chr05 Coordinates: 116735044-116739383 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2967 bp · LXL04_025767|LXL04_025767|OH1004|cDNA

atggcatcttcatcatcatctccttctcttcccGTCCTTTCTTCTCAATCATGGAATTATGACGTTTTCCTTAGTTTTAGAGGAGAAGATACTCGCAAGACTTTTGTAGATCATCTCTACAAAGCCCTTGATCAACAAGGGATCTACACTTACAAGGATGATGTAACACTTCCACGGGGGGAATCGATCAGCCTTGCTCTTTCGAAGGCTATTGAAGAATCACAGATCGCACTTATCATTTTTTCTAAGAACTATGCAAA...

CDS

Download CDS FASTA

2967 bp · LXL04_025767|LXL04_025767|OH1004|CDS

ATGGCATCTTCATCATCATCTCCTTCTCTTCCCGTCCTTTCTTCTCAATCATGGAATTATGACGTTTTCCTTAGTTTTAGAGGAGAAGATACTCGCAAGACTTTTGTAGATCATCTCTACAAAGCCCTTGATCAACAAGGGATCTACACTTACAAGGATGATGTAACACTTCCACGGGGGGAATCGATCAGCCTTGCTCTTTCGAAGGCTATTGAAGAATCACAGATCGCACTTATCATTTTTTCTAAGAACTATGCAAA...

Protein

Download Protein FASTA

988 aa · LXL04_025767|LXL04_025767|OH1004|PROTEIN

MASSSSSPSLPVLSSQSWNYDVFLSFRGEDTRKTFVDHLYKALDQQGIYTYKDDVTLPRGESISLALSKAIEESQIALIIFSKNYANSKWCLIELTYIMKRMEEGKLTVIPIFYDVKPTELRNQEWECKEAFDVHELENKAKVESWRKALVEASNISGWEPKQIADGHEAQGIQQFVDNISQRLVTSRANEDLVGMRTRVQGLKSKLHIEAGGVRMIGVWGVGGGGKSTLASYIYDDISSNFDSCCFVKNIREEASYHGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025767`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025767

Location Chr05:116735044-116739383 (-)

Description Similar to ROQ1: Disease resistance protein Roq1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11170`	Putative disease resistance protein At4g11170.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025767 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0043531 ADP binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.382

Rank 1 · LXL04_025767 · OH-1004

Cell membrane0.353

Rank 2 · LXL04_025767 · OH-1004

Nucleus0.308

Rank 3 · LXL04_025767 · OH-1004

Endoplasmic reticulum0.082

Rank 4 · LXL04_025767 · OH-1004

Plastid0.052

Rank 5 · LXL04_025767 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582.26TIR19-189 aa

PF13676.12TIR_222-127 aa

PF00931.29NB-ARC199-366 aa

PF23282.2WHD_ROQ1434-505 aa

PF12799.14LRR_4682-724 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025767	`PF01582.26`	TIR	19	189	1.4e-45	156.0
LXL04_025767	`PF13676.12`	TIR_2	22	127	2.6e-18	67.4
LXL04_025767	`PF00931.29`	NB-ARC	199	366	9.6e-19	68.3
LXL04_025767	`PF23282.2`	WHD_ROQ1	434	505	5.5e-16	59.2
LXL04_025767	`PF12799.14`	LRR_4	682	724	1.3e-08	35.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82500`	Arabidopsis thaliana	Putative disease resistance protein At4g11170	32.293%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card