TkA06G036570 | RubberDandelionOmics

Gene overview

TkA06G036570

Reference: TK1151 Chr: Chr06 Coordinates: 9800914-9805885 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3422 bp · TkA06G036570|TK1151|cDNA

ATGTTCTCCACAATGAATTCAATTGCGGTGTTTTCCAGTGTGTGTAAATGATGAATGAACAGTTGAACACAAGGTGTTTGTATAAATGTCTGTGATAGATTCTTCAACAGATCTACAGTGAAAAGAGGTTTACAGAGGATGACGAGACGAGATGAATCGCAAACGCCAGATGGATTTTCCCCAATTTGAAGTTCTTCTGCTTTTCTGATCCGATTGGCATCCAATAACGAGCGTATTCGTGGAAATGAATATTGCGATTC...

CDS

Download CDS FASTA

2763 bp · TkA06G036570|TK1151|CDS

ATGGTGCACGAGATGGAGGATGATCATGTTGAAGATATGGAGGTCGAAGTTGAAGTCCTCTCATCAATGTGGCCTGAAGGCATTGACGAAGCTGGAAAAAAGTTCAACCTAGAAAAACCAGGATTACATGAAGACATGTTAGAGGATCTTGCCTTCATTGAAGAACCTAGTATAGTTGACTTCAAACGATTAGTAGAACTCACAAGTTACAGTGAAAAAGGCTCCTCACAGTTGGCTTACCTTGTACAAAACTGGGAATA...

Protein

Download Protein FASTA

920 aa · TkA06G036570|TK1151|PROTEIN

MVHEMEDDHVEDMEVEVEVLSSMWPEGIDEAGKKFNLEKPGLHEDMLEDLAFIEEPSIVDFKRLVELTSYSEKGSSQLAYLVQNWEYKQENAVRLLREELESLSKQQHEVQLKKLEIFEQHRFEESYGGDKRPVSVLDEVIEIFQDVPKKRNDIIVQDKRVEIDAEYDTVIYWKQKALHLGKLLEESVQREHLLLEKLEESIENLEKQSSPVEELSQILKRADNFLHFVLQNAPVVIGHQDQDLRYRFIYNHFPSLGEED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G036570`
TK1151 ID	TkA06G036570
OH-1004 ID	LXL04_025931
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 98.587 / OH-1004 97.318 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G036570

Location Chr06:9800914-9805885 (+)

Description Similar to AHK5: Histidine kinase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10720`	Functions as a histidine kinase and transmits the stress signal to a downstream MAPK cascade.	AHK5 histidine kinase regulates root elongation through an ETR1-dependent abscisic acid and ethylene signaling pathway in Arabidopsis thaliana.2007 · DOI: 10.1093/pcp/pcl065 The histidine kinase AHK5 integrates endogenous and environmental signals in Arabidopsis guard cells.2008 · DOI: 10.1371/journal.pone.0002491 Arabidopsis histidine kinase 5 regulates salt sensitivity and resistance against bacterial and fungal infection.2012 · DOI: 10.1111/j.1469-8137.2011.04033.x Modulation of ROS production and hormone levels by AHK5 during abiotic and biotic stress signaling.2012 · DOI: 10.4161/psb.20692

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YFR6`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release
`Os06g0654300`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release
`Os02g0738400`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025931 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006952 defense response Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010105 negative regulation of ethylene-activated signaling pathway Biological Process

GO:0048364 root development Biological Process

GO:0070301 cellular response to hydrogen peroxide Biological Process

GO:0071219 cellular response to molecule of bacterial origin Biological Process

GO:0071732 cellular response to nitric oxide Biological Process

GO:0090333 regulation of stomatal closure Biological Process

KEGG gene cross-reference

ath:AT5G10720

dosa:Os06g0654300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.486

Rank 1 · TkA06G036570 · TK1151

Nucleus0.318

Rank 2 · TkA06G036570 · TK1151

Cell membrane0.154

Rank 3 · TkA06G036570 · TK1151

Golgi apparatus0.112

Rank 4 · TkA06G036570 · TK1151

Endoplasmic reticulum0.095

Rank 5 · TkA06G036570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00512HisKA91-109 aa

PF06050HGD-D169-223 aa

PF00512HisKA183-216 aa

PF08448PAS_4231-336 aa

PF17202sCache_3_3290-338 aa

PF00072Response_reg321-349 aa

PF06050HGD-D340-399 aa

PF00512HisKA373-436 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G036570	`PF00512`	HisKA	91	109	4.6e-18	65.7
TkA06G036570	`PF06050`	HGD-D	169	223	0.082	13.1
TkA06G036570	`PF00512`	HisKA	183	216	4.6e-18	65.7
TkA06G036570	`PF08448`	PAS_4	231	336	0.096	13.6
TkA06G036570	`PF17202`	sCache_3_3	290	338	0.093	13.8
TkA06G036570	`PF00072`	Response_reg	321	349	4.6e-21	75.8
TkA06G036570	`PF06050`	HGD-D	340	399	0.082	13.1
TkA06G036570	`PF00512`	HisKA	373	436	4.6e-18	65.7
TkA06G036570	`PF02518`	HATPase_c	482	632	2.8e-28	99.3
TkA06G036570	`PF13589`	HATPase_c_3	558	625	0.097	13.4
TkA06G036570	`PF00072`	Response_reg	775	843	4.6e-21	75.8
TkA06G036570	`PF00072`	Response_reg	864	915	4.6e-21	75.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3S4A7`	Arabidopsis thaliana	sp\|Q3S4A7\|AHK5_ARATH Histidine kinase 5	59.300%	Swiss-Prot	High
`A2YFR6`	Oryza sativa subsp. indica	sp\|A2YFR6\|OHK1_ORYSI Probable histidine kinase 1	53.200%	Swiss-Prot	High
`A3BE68`	Oryza sativa subsp. japonica	sp\|A3BE68\|OHK1_ORYSJ Probable histidine kinase 1	53.100%	Swiss-Prot	High
`A1A699`	Oryza sativa subsp. japonica	sp\|A1A699\|OHK6_ORYSJ Probable histidine kinase 6	30.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card