LXL04_025931 | RubberDandelionOmics

Gene overview

LXL04_025931

Reference: OH-1004 Chr: Chr05 Coordinates: 118661426-118665896 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2799 bp · LXL04_025931|LXL04_025931|OH1004|cDNA

ATGGTGCACGAGATGGAGGATGATCATGTTGAAGATATGGAGGTCGAAGTTGAAGTCCTCTCATCAATGTGGCCTGAAGGCATTGACGAAGCTGGAAAAAAGTTCAACCTAGAAAAACCAGGATTACATGAAGACATGTTAGAGGATCTTGCCTTCATTGAAGAACCTAGTATAGTTGACTTCAAACGATTAGTAGAACTCACAAGTTACAGTGAAAAAGGCTCCTCACAGTTGGCTTACCTTGTACAAAACTGGGAATA...

CDS

Download CDS FASTA

2799 bp · LXL04_025931|LXL04_025931|OH1004|CDS

ATGGTGCACGAGATGGAGGATGATCATGTTGAAGATATGGAGGTCGAAGTTGAAGTCCTCTCATCAATGTGGCCTGAAGGCATTGACGAAGCTGGAAAAAAGTTCAACCTAGAAAAACCAGGATTACATGAAGACATGTTAGAGGATCTTGCCTTCATTGAAGAACCTAGTATAGTTGACTTCAAACGATTAGTAGAACTCACAAGTTACAGTGAAAAAGGCTCCTCACAGTTGGCTTACCTTGTACAAAACTGGGAATA...

Protein

Download Protein FASTA

932 aa · LXL04_025931|LXL04_025931|OH1004|PROTEIN

MVHEMEDDHVEDMEVEVEVLSSMWPEGIDEAGKKFNLEKPGLHEDMLEDLAFIEEPSIVDFKRLVELTSYSEKGSSQLAYLVQNWEYKQENAVRLLREELESLSKQQHEVQLKKLEIFEQHRFEESYGGDKRPVSVLDEVIEIFQDVPKKRNDIIVQDKRVEIDAEYDTVIYWKQKALHLGKLLEESVQREHLLLEKLEESIENLEKQSSPVEELSQILKRADNFLHFVLQNAPVVIGHQDQDLRYRFIYNHFPSLGEED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025931`
TK1151 ID	TkA06G036570
OH-1004 ID	LXL04_025931
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 98.587 / OH-1004 97.318 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025931

Location Chr05:118661426-118665896 (+)

Description Similar to AHK5: Histidine kinase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10720`	Functions as a histidine kinase and transmits the stress signal to a downstream MAPK cascade.	AHK5 histidine kinase regulates root elongation through an ETR1-dependent abscisic acid and ethylene signaling pathway in Arabidopsis thaliana.2007 · DOI: 10.1093/pcp/pcl065 The histidine kinase AHK5 integrates endogenous and environmental signals in Arabidopsis guard cells.2008 · DOI: 10.1371/journal.pone.0002491 Arabidopsis histidine kinase 5 regulates salt sensitivity and resistance against bacterial and fungal infection.2012 · DOI: 10.1111/j.1469-8137.2011.04033.x Modulation of ROS production and hormone levels by AHK5 during abiotic and biotic stress signaling.2012 · DOI: 10.4161/psb.20692

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YFR6`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release
`Os06g0654300`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025931 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006952 defense response Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010105 negative regulation of ethylene-activated signaling pathway Biological Process

GO:0048364 root development Biological Process

GO:0070301 cellular response to hydrogen peroxide Biological Process

GO:0071219 cellular response to molecule of bacterial origin Biological Process

GO:0071732 cellular response to nitric oxide Biological Process

GO:0090333 regulation of stomatal closure Biological Process

KEGG gene cross-reference

ath:AT5G10720

dosa:Os06g0654300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.473

Rank 1 · LXL04_025931 · OH-1004

Nucleus0.322

Rank 2 · LXL04_025931 · OH-1004

Cell membrane0.156

Rank 3 · LXL04_025931 · OH-1004

Golgi apparatus0.104

Rank 4 · LXL04_025931 · OH-1004

Endoplasmic reticulum0.094

Rank 5 · LXL04_025931 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00512.32HisKA373-436 aa

PF02518.32HATPase_c482-632 aa

PF00072.31Response_reg775-843 aa

PF00072.31Response_reg864-907 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025931	`PF00512.32`	HisKA	373	436	4.7e-18	65.7
LXL04_025931	`PF02518.32`	HATPase_c	482	632	2.9e-28	99.2
LXL04_025931	`PF00072.31`	Response_reg	775	843	1.1e-19	71.4
LXL04_025931	`PF00072.31`	Response_reg	864	907	1.1e-19	71.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3S4A7`	Arabidopsis thaliana	Histidine kinase 5	58.201%	Swiss-Prot	strong database homology
`A2YFR6`	Oryza sativa subsp. indica	Probable histidine kinase 1	52.121%	Swiss-Prot	strong database homology
`A3BE68`	Oryza sativa subsp. japonica	Probable histidine kinase 1	52.020%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card