TkA06G034140 | RubberDandelionOmics

Gene overview

TkA06G034140

Reference: TK1151 Chr: Chr06 Coordinates: 9218219-9220007 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1268 bp · TkA06G034140|TK1151|cDNA

TTGAGTTTCACTTCTCGTAGAAGCAAGAACGTGGCAATTATGGTTTTCGGTGTTAGTGTTCAGGCAGGAATTCGGCTCGTAAATTCTAATTTCTTCGAAAATCCAGAGTAGACTGAAAGATAAGAAAGAAGATAGATTGAGCATGGAGTATCATTAACGAGGTATAGCAAAGCATGGAGTATGATCACAATAATCCCAGAGAAGTGATAGAAGAAGATAGATTGAGCAACTTACCAGATGAGCTTATTCACAAGATCATG...

CDS

Download CDS FASTA

1095 bp · TkA06G034140|TK1151|CDS

ATGGAGTATGATCACAATAATCCCAGAGAAGTGATAGAAGAAGATAGATTGAGCAACTTACCAGATGAGCTTATTCACAAGATCATGTCTTGTTTTGACCTAAAATTTGCTGTTCAAACATGTTTGCTGTCATCAAGATGGGAGTCTCTCTGGACATCATTACCATATCTTAACTTCTCAAGCACCCAATTTGGTAATTTACCGAAGTTTGACGAATTCGTGACTCAATTTCTAACTCACCGAAACCATCAAATAGAAGT...

Protein

Download Protein FASTA

365 aa · TkA06G034140|TK1151|PROTEIN

MEYDHNNPREVIEEDRLSNLPDELIHKIMSCFDLKFAVQTCLLSSRWESLWTSLPYLNFSSTQFGNLPKFDEFVTQFLTHRNHQIEVSSVKLNFRGAVNQSFVKKIASYAFSHNVQQLDVTCWPNAVDIANFHSCLFSSQTLKHYTLSSLLAYASCITPKTPLDFPSLTTLNLGGFSLRGYKRKESVDLFSKCVNLKNLTLGRFLLQSVDVFDIITPCLSNLVLTNGHCSKVINVISPRLENLTIKDCSIKYLNAPSRIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G034140`
TK1151 ID	TkA06G034140
OH-1004 ID	LXL04_025892
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	59.300
Protein coverage (%)	TK1151 98.630 / OH-1004 14.314 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G034140

Location Chr06:9218219-9220007 (+)

Description Similar to PDH-E1 ALPHA: Pyruvate dehydrogenase E1 component subunit alpha-3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00160`	F-box/FBD/LRR-repeat protein At4g00160.	No verified direct reference in this release
`At3g52680`	F-box/FBD/LRR-repeat protein At3g52680.	No verified direct reference in this release
`At3g52670`	FBD-associated F-box protein At3g52670.	No verified direct reference in this release
`At3g49030`	Putative F-box/FBD/LRR-repeat protein At3g49030.	No verified direct reference in this release
`At5g02920`	F-box/LRR-repeat protein 25.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025892 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006086 pyruvate decarboxylation to acetyl-CoA Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0045254 pyruvate dehydrogenase complex Cellular Component

GO:0004739 pyruvate dehydrogenase (acetyl-transferring) activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G01090

dosa:Os04g0119400

rco:RC0347

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.848

Rank 1 · TkA06G034140 · TK1151

Cytoplasm0.188

Rank 2 · TkA06G034140 · TK1151

Endoplasmic reticulum0.034

Rank 3 · TkA06G034140 · TK1151

Cell membrane0.034

Rank 4 · TkA06G034140 · TK1151

Plastid0.015

Rank 5 · TkA06G034140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box17-55 aa

PF12937F-box-like17-50 aa

PF13855LRR_852-63 aa

PF12799LRR_456-68 aa

PF24758LRR_At5g56370112-256 aa

PF13855LRR_8158-189 aa

PF12799LRR_4163-176 aa

PF12799LRR_4186-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G034140	`PF00646`	F-box	17	55	5.4e-08	33.2
TkA06G034140	`PF12937`	F-box-like	17	50	0.028	14.9
TkA06G034140	`PF13855`	LRR_8	52	63	2.3	8.8
TkA06G034140	`PF12799`	LRR_4	56	68	0.019	15.9
TkA06G034140	`PF24758`	LRR_At5g56370	112	256	3.9e-07	30.7
TkA06G034140	`PF13855`	LRR_8	158	189	2.3	8.8
TkA06G034140	`PF12799`	LRR_4	163	176	0.019	15.9
TkA06G034140	`PF12799`	LRR_4	186	210	0.019	15.9
TkA06G034140	`PF13855`	LRR_8	187	210	2.3	8.8
TkA06G034140	`PF12799`	LRR_4	238	256	0.019	15.9
TkA06G034140	`PF13855`	LRR_8	238	244	2.3	8.8
TkA06G034140	`PF24758`	LRR_At5g56370	325	359	3.9e-07	30.7
TkA06G034140	`PF13855`	LRR_8	339	354	2.3	8.8
TkA06G034140	`PF12799`	LRR_4	341	351	0.019	15.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LF09`	Arabidopsis thaliana	sp\|Q8LF09\|FDL23_ARATH F-box/FBD/LRR-repeat protein At4g00160	29.600%	Swiss-Prot	Low
`Q9LXJ6`	Arabidopsis thaliana	sp\|Q9LXJ6\|FDL21_ARATH F-box/FBD/LRR-repeat protein At3g52680	29.600%	Swiss-Prot	Low
`Q9LXJ7`	Arabidopsis thaliana	sp\|Q9LXJ7\|FBD11_ARATH FBD-associated F-box protein At3g52670	30.100%	Swiss-Prot	Medium
`Q9SMU0`	Arabidopsis thaliana	sp\|Q9SMU0\|FDL18_ARATH Putative F-box/FBD/LRR-repeat protein At3g49030	26.900%	Swiss-Prot	Low
`Q1PE04`	Arabidopsis thaliana	sp\|Q1PE04\|FBL25_ARATH F-box/LRR-repeat protein 25	30.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card