TkA06G031610 | RubberDandelionOmics

Gene overview

TkA06G031610

Reference: TK1151 Chr: Chr06 Coordinates: 8592630-8593121 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

492 bp · TkA06G031610|TK1151|cDNA

ATGATGACGCCAGCATCTTCCGAGTTCACCCGTCGTTTGCACACAGTCATCGCCACCCGCTCCCTTCTAAAAGCCCTTCTGACCACCACCTGTGCCATCTGCACCGACGATTACCTCCGCCAAGATGAGCTTGTGAGGCTACCAAACTGCCGCCACCTCTTCCACCGGAAGTGTATATGGTTCTCCAGAAACAACACCTGCCCCCTCTGCCGTCGTGTCTTCCCGGCAGAGCAGCCAAAGCGTTATACCGTGCCGTTAAG...

CDS

Download CDS FASTA

492 bp · TkA06G031610|TK1151|CDS

ATGATGACGCCAGCATCTTCCGAGTTCACCCGTCGTTTGCACACAGTCATCGCCACCCGCTCCCTTCTAAAAGCCCTTCTGACCACCACCTGTGCCATCTGCACCGACGATTACCTCCGCCAAGATGAGCTTGTGAGGCTACCAAACTGCCGCCACCTCTTCCACCGGAAGTGTATATGGTTCTCCAGAAACAACACCTGCCCCCTCTGCCGTCGTGTCTTCCCGGCAGAGCAGCCAAAGCGTTATACCGTGCCGTTAAG...

Protein

Download Protein FASTA

163 aa · TkA06G031610|TK1151|PROTEIN

MMTPASSEFTRRLHTVIATRSLLKALLTTTCAICTDDYLRQDELVRLPNCRHLFHRKCIWFSRNNTCPLCRRVFPAEQPKRYTVPLRFQSVCFNRQERDTDHVFHLHFHLRSMPPSNPDDLWPPVGHLQQVLVEEGYPELATRACGPYWVSINRIQQSTAGSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G031610`
TK1151 ID	TkA06G031610
OH-1004 ID	LXL04_026016
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G031610

Location Chr06:8592630-8593121 (+)

Description Similar to At3g19950: E3 ubiquitin-protein ligase RING1-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61550`	RING-H2 finger protein ATL68.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026016 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0034122 negative regulation of toll-like receptor signaling pathway Biological Process

GO:0034123 positive regulation of toll-like receptor signaling pathway Biological Process

GO:0034142 toll-like receptor 4 signaling pathway Biological Process

GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway Biological Process

GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process

KEGG gene cross-reference

ath:AT3G19950

ath:AT5G20910

hsa:27246

mmu:67845

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.654

Rank 1 · TkA06G031610 · TK1151

Cytoplasm0.444

Rank 2 · TkA06G031610 · TK1151

Mitochondrion0.062

Rank 3 · TkA06G031610 · TK1151

Cell membrane0.037

Rank 4 · TkA06G031610 · TK1151

Endoplasmic reticulum0.035

Rank 5 · TkA06G031610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07803GSG-114-63 aa

PF14569zf-UDP24-74 aa

PF17120zf-RING_1628-68 aa

PF13901RH_dom29-72 aa

PF14446Prok-RING_129-59 aa

PF13920zf-C3HC4_329-72 aa

PF23475zf-Tbcl_FmdE29-38 aa

PF13639zf-RING_230-71 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G031610	`PF07803`	GSG-1	14	63	0.074	13.6
TkA06G031610	`PF14569`	zf-UDP	24	74	0.068	14.0
TkA06G031610	`PF17120`	zf-RING_16	28	68	0.056	13.8
TkA06G031610	`PF13901`	RH_dom	29	72	0.0025	18.4
TkA06G031610	`PF14446`	Prok-RING_1	29	59	0.0033	18.3
TkA06G031610	`PF13920`	zf-C3HC4_3	29	72	0.0033	17.9
TkA06G031610	`PF23475`	zf-Tbcl_FmdE	29	38	0.08	13.1
TkA06G031610	`PF13639`	zf-RING_2	30	71	4.3e-13	50.0
TkA06G031610	`PF14835`	zf-RING_6	30	71	0.022	15.3
TkA06G031610	`PF27108`	PHD_Pygo	30	62	0.27	12.1
TkA06G031610	`PF26037`	zf-RING_DCST1_C	30	72	0.36	11.6
TkA06G031610	`PF21533`	EHMT1-2_CRR	30	71	0.5	11.5
TkA06G031610	`PF23413`	zf_RING_Vps8_fungal	30	36	1.2	9.2
TkA06G031610	`PF17123`	zf-RING_11	31	59	1.2e-08	35.2
TkA06G031610	`PF13445`	zf-RING_UBOX	31	68	6.6e-07	29.9
TkA06G031610	`PF00097`	zf-C3HC4	31	70	2e-05	25.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M313`	Arabidopsis thaliana	sp\|Q9M313\|ATL68_ARATH RING-H2 finger protein ATL68	42.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card