TkA06G031270 | RubberDandelionOmics

Gene overview

TkA06G031270

Reference: TK1151 Chr: Chr06 Coordinates: 8530891-8531666 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

560 bp · TkA06G031270|TK1151|cDNA

CATTAACTTCTCTAAAAAAAACTCCATAATTACTTTCAATGTCATTTAAATCCATTTTCATGAATTGAATTTGCTACAGATTATGTATGATGTCACTGACATGGAAAGCTTCAACAATGTGAAACAATGGATAAGTGAATTTGATAGATATGCAAACGAATCAGTCTGCAAGCTTCTTGTAGGAAACAAATGCGATCTAATTGAGAACACGGTTGTTGATACACAAACCGCCAAGGCATTTGCAGATGAGCTTGGGATCC...

CDS

Download CDS FASTA

345 bp · TkA06G031270|TK1151|CDS

ATGTATGATGTCACTGACATGGAAAGCTTCAACAATGTGAAACAATGGATAAGTGAATTTGATAGATATGCAAACGAATCAGTCTGCAAGCTTCTTGTAGGAAACAAATGCGATCTAATTGAGAACACGGTTGTTGATACACAAACCGCCAAGGCATTTGCAGATGAGCTTGGGATCCCTTTCCTTGAGACCAGTGCAAAAGACTTGGTTAATGTGGAACAAGCTTTCTTGACAATGGCTGCTGAGATTAAGAAAAAACA...

Protein

Download Protein FASTA

114 aa · TkA06G031270|TK1151|PROTEIN

MYDVTDMESFNNVKQWISEFDRYANESVCKLLVGNKCDLIENTVVDTQTAKAFADELGIPFLETSAKDLVNVEQAFLTMAAEIKKKHWVIRSQGALFKLKGSQLSRKAIVVVNG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G031270`
TK1151 ID	TkA06G031270
OH-1004 ID	LXL04_005602
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.700
Protein coverage (%)	TK1151 100.000 / OH-1004 44.882 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G031270

Location Chr06:8530891-8531666 (+)

Description Similar to YPTM1: GTP-binding protein YPTM1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11730`	Protein transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005602 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006897 endocytosis Biological Process

GO:0006914 autophagy Biological Process

GO:0007030 Golgi organization Biological Process

GO:0009555 pollen development Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0016477 cell migration Biological Process

GO:0030252 growth hormone secretion Biological Process

KEGG gene cross-reference

ath:AT3G11730

ath:AT4G17530

rno:81754

zma:542531

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.536

Rank 1 · TkA06G031270 · TK1151

Golgi apparatus0.247

Rank 2 · TkA06G031270 · TK1151

Nucleus0.170

Rank 3 · TkA06G031270 · TK1151

Cell membrane0.144

Rank 4 · TkA06G031270 · TK1151

Endoplasmic reticulum0.138

Rank 5 · TkA06G031270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00071Ras1-84 aa

PF08477Roc4-38 aa

PF00004AAA13-44 aa

PF29775YqxG_N42-90 aa

PF00004AAA47-75 aa

PF08477Roc79-79 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G031270	`PF00071`	Ras	1	84	1.3e-25	90.6
TkA06G031270	`PF08477`	Roc	4	38	0.0002	22.3
TkA06G031270	`PF00004`	AAA	13	44	0.024	15.8
TkA06G031270	`PF29775`	YqxG_N	42	90	0.16	12.9
TkA06G031270	`PF00004`	AAA	47	75	0.024	15.8
TkA06G031270	`PF08477`	Roc	79	79	0.0002	22.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZRE2`	Arabidopsis thaliana	sp\|Q9ZRE2\|RABD1_ARATH Ras-related protein RABD1	76.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card